KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0615Help
Entry
Pnec_0615         CDS       T00683                                 

Definition
(GenBank) hypothetical protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
531186..531305
Genome map
AA seq 39 aa AA seqDB search
MQIEVRSTLIVKTHADGRASVDLIWLSQLPKTLVEEALL
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgaagttcgctcaactcttattgttaaaacccatgctgatggcagggcctct
gtagaccttatttggctttctcagttgccaaagacattggtcgaggaagctctcttgtag

DBGET integrated database retrieval system