KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0617Help
Entry
Pnec_0617         CDS       T00683                                 

Definition
(GenBank) transcriptional regulator of molybdate metabolism, LysR family
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
531580..531777
Genome map
AA seq 65 aa AA seqDB search
MIQKAAGEIKGVELKIAGSGESLERLLNNEAHIAGYHVSDPNSSKAIYQRLSKCDIEIYP
VMKRT
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgattcaaaaagcagccggagagatcaagggcgtcgagctcaagattgctggctcaggc
gaatctttagagaggcttctcaataatgaagcgcatattgctggatatcatgtttccgat
ccgaatagttccaaagcaatatatcaacgactatcaaaatgcgatattgaaatttatccc
gtcatgaagcggacgtaa

DBGET integrated database retrieval system