KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0620Help
Entry
Pnec_0620         CDS       T00683                                 

Definition
(GenBank) molybdenum ABC transporter, periplasmic molybdate-binding protein
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
532804..532992
Genome map
AA seq 62 aa AA seqDB search
MAKSSEVAKETKFLLLNSKMYESIKQRMVLIKDAPQEASDLYRFMQEPQAKAILQKYGYT
TP
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaagtcgtctgaagtagcaaaagaaaccaaattcttgttactcaacagcaagatg
tatgagtccatcaagcaacgcatggttctgattaaagacgcacctcaagaggcatctgat
ttatatcgatttatgcaagagcctcaagccaaagctattctgcaaaaatacggttacact
accccttag

DBGET integrated database retrieval system