KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0622Help
Entry
Pnec_0622         CDS       T00683                                 

Definition
(GenBank) FeoA family protein
  KO
K04758  
ferrous iron transport protein A
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Transporters [BR:pne02000]
 Other Transporters
  Others
   Pnec_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
533821..534066
Genome map
AA seq 81 aa AA seqDB search
MNLDQVDLGSLYRVIEIDVPKGAPQIKGQLEDIGFLPGEQVAVLRKGLLGKGPYMVRVGA
STFALRQSEARMILVETLSHV
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaccaagttgacttaggtagtctttatcgggttatcgagatagatgtgccc
aaaggggcgcctcaaattaaggggcagttggaagatattggctttttacctggcgagcaa
gttgccgtattgcgtaaaggtttgcttggcaagggcccctatatggtccgcgtgggcgcc
tcaacttttgcgttgcgccaatcagaggcgcgcatgattttggttgaaaccttgtcgcat
gtctga

DBGET integrated database retrieval system