KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0623Help
Entry
Pnec_0623         CDS       T00683                                 

Definition
(GenBank) ferrous iron transport protein B
  KO
K04759  
ferrous iron transport protein B
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Transporters [BR:pne02000]
 Other Transporters
  Others
   Pnec_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
534059..535972
Genome map
AA seq 637 aa AA seqDB search
MSESKAYFFPSEPLVALLGNPNCGKTALFNLLTGSRQKVANYSGVTVERKEGRLALESGK
NIRILDLPGAHSLYPRSLDEHVTCNVLLGRAEGEKRPDLVICVLSAMNLRRNLRLVLAAK
RLGLPCIVVLNMLDIAKRQGLQIDTAALSNELGLPVLTSIGIQSNGADEIKHFLSELDWR
NLNGLRTGTSDATLENVATHIAHTESDNVQVQRILQNLKLDRIIPDHLSDRLDVVLLHPV
IGPMILVALLFCIFQAVFSWATVPMDLIKAGVEFLGSQIAALLPNDWLRSLLINGILAGL
GGVVIFLPQILILFFFILLLEESGYLPRAAYLLDRVMGSVGLSGRSFIPLLSSFACAIPG
IMATRSISNARDRIVTILIAPMMTCSARLPVYALLISAFIPEQKLWAGIDLQGLVLFLLY
LSGILGAMVVAWILKRFTSEQFKMNALMMELPSYHMPRLGNLAISLWQRAEIFLRRVGGI
ILVMTIGLWVLSSFPFPPEGATGSPIQYSFAGMLGQRLAHIFSPIGFNWQISIALVPGMA
AREVVVSSLATVYALSSSSVDATDALIPLISSGWSLATALSLLAWFVFAPQCLSTIAAVK
RETGGWKIPVIMMGYLFGLAYIAAFITYQIASALGLA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatctaaagcctacttttttcctagtgagccactcgtagccttattgggtaat
cccaattgcggcaaaacagcattatttaatttgcttaccggcagtcgtcaaaaggtggca
aattattctggcgtaactgttgagcgcaaagaagggcgattagctttagagtctggaaaa
aatatccgcattctggatttgcctggtgcccacagtctgtacccaagatctttagatgag
catgtgacctgtaacgttctgcttggtagggctgagggcgagaaacgtcctgatttggtg
atctgcgttctgagtgcaatgaatttacgtcgtaatttgcgcttggtcttggccgcaaaa
cgcctaggtttgccttgtatcgttgtactcaacatgctcgatatcgccaagcgtcagggc
ttgcagatcgataccgctgccttatcaaatgagctcggtttgccagtacttaccagtatt
ggcattcagtctaatggcgcagatgagatcaaacactttttatcagagcttgattggcgc
aatctcaatggattacgcactggaacaagtgatgccactctagagaatgttgccactcat
attgcacatacagaatcagacaatgttcaagtgcaaagaatattgcaaaacctgaagcta
gatcgaatcattcccgatcatttgagtgatcgattggatgtggtgttattgcacccagtg
attggccccatgattttggtagcgctactcttttgtatctttcaggcagtctttagttgg
gcaactgtgcctatggatcttattaaggccggagttgaatttctaggtagtcagatagca
gcgttattgccaaatgattggttgcgtagtttactgatcaatggaattttggcgggcttg
ggtggtgtcgtgattttcttgccgcaaattttgattttgtttttctttattcttttactt
gaagagtctggctatcttccaagggctgcgtatctattagatagggtgatgggttcagtt
ggactctccggcagatcctttatccctctgctttctagttttgcctgtgcgatccctggg
attatggcgaccagaagcatttcgaacgcacgggatcgcattgtaactatcctgattgcg
ccgatgatgacatgctcagcgcgcttgccggtatatgctttattgatctcagcatttatt
ccggagcaaaagctctgggctggtatcgatcttcagggcttggtgctgtttttgctttat
ctgtctggaattttaggtgctatggttgtcgcctggattctaaaacgctttacaagtgag
caatttaaaatgaatgcgctcatgatggaattgcctagttaccatatgccgcgtttagga
aatttggctattagtttatggcagcgcgctgaaatatttttgcgtcgagttggcggcatc
attttagtgatgacgattggattgtgggttttatccagctttccatttccaccagagggc
gcaacaggatcgcctattcaatatagctttgccggaatgctggggcagcgcttggcgcat
attttttcaccgatcggttttaactggcaaattagcattgctttagtgccagggatggcg
gcacgcgaagtggtagtgagctcattggctacggtatatgcgctttccagctcaagcgta
gatgcaactgacgcgcttattccactgatctctagcggctggtctttggctaccgcacta
tcgttattggcttggtttgtgttcgctccccagtgcctgtctacgattgcggcagttaag
cgcgagactggaggctggaagatcccagtcattatgatgggctatctctttggactggcc
tacattgccgcctttattacctaccaaatcgccagcgccctaggcttggcttga

DBGET integrated database retrieval system