KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0646Help
Entry
Pnec_0646         CDS       T00683                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pnec_0646
DNA repair and recombination proteins [BR:pne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pnec_0646
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pnec_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
560531..561145
Genome map
AA seq 204 aa AA seqDB search
MARIEAPQDALGRLIEALRVLPGVGPKSAQRMAFYLLQHDRNGAAVLAQSLGEAVETVGH
CACCNTFSETQVCSTCSDERRDPSLLCIVETPADQVMVEQTLSFKGNYFVLMGRLSPLDG
MGPNEISFDRLLNRIETPDTGVPIREVVLATNFTSEGEATAHYIGEVLKPKGIKVTRIAR
GIPVGGELEYVDAGTLARALMDRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtatagaagcacctcaagatgcacttggtcgtttgattgaggcattacgtgtg
cttcctggagtaggccctaagtctgctcagcgtatggcgttctatctgttgcagcatgat
cgcaatggtgctgcagtgcttgctcaatcattgggtgaggcggtagagacagtggggcac
tgcgcttgttgtaacacgttttcagaaacacaggtctgcagtacatgctctgacgagcgt
cgcgatccatcgctgttgtgcattgtggaaacgcctgctgatcaggtgatggtggagcaa
accttaagctttaaaggcaactactttgtattgatggggcgactctcacctctcgatggc
atgggcccaaatgagatcagctttgatcgcttactcaatcgtattgagactcccgatact
ggggttcctattcgagaagtggtgttggccacgaatttcactagtgaaggtgaggcaacg
gcccattacatcggcgaagtgctgaagcccaaaggcatcaaggtcacccgtattgcacgc
ggcattccggtgggtggtgagctcgaatatgttgatgccggcacgctagctcgcgcctta
atggatcgtcgctaa

DBGET integrated database retrieval system