KEGG   Polynucleobacter necessarius: Pnec_0677Help
Entry
Pnec_0677         CDS       T00683                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pne  Polynucleobacter necessarius
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pne01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pne00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pne00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588492..588779
Genome map
AA seq 95 aa AA seqDB search
MTARTTCNSLQVATPLYRFIEDKVLPGTGIKSADFWKGFDEIVKDLTPKNEALLAKRDRI
QADLDKWHQANPGPIKDMPAYRQFLKQIDYLVINP
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcgtactacttgcaatagccttcaagtggcaacccctttgtatcgctttatc
gaagataaagtgcttccaggtaccggcattaaaagtgctgatttttggaagggctttgat
gaaattgttaaagacttaaccccaaaaaatgaggctttgcttgctaagcgcgatcgcatt
caggcggacttggataaatggcatcaagccaatccaggaccaatcaaagacatgcctgca
tatcgtcagtttttgaagcagatcgattacctagttattaacccatag

DBGET integrated database retrieval system