KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0677Help
Entry
Pnec_0677         CDS       T00683                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnec_0677
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnec_0677
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0677
Enzymes [BR:pne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pnec_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588492..588779
Genome map
AA seq 95 aa AA seqDB search
MTARTTCNSLQVATPLYRFIEDKVLPGTGIKSADFWKGFDEIVKDLTPKNEALLAKRDRI
QADLDKWHQANPGPIKDMPAYRQFLKQIDYLVINP
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcgtactacttgcaatagccttcaagtggcaacccctttgtatcgctttatc
gaagataaagtgcttccaggtaccggcattaaaagtgctgatttttggaagggctttgat
gaaattgttaaagacttaaccccaaaaaatgaggctttgcttgctaagcgcgatcgcatt
caggcggacttggataaatggcatcaagccaatccaggaccaatcaaagacatgcctgca
tatcgtcagtttttgaagcagatcgattacctagttattaacccatag

DBGET integrated database retrieval system