KEGG   Polynucleobacter necessarius: Pnec_0677Help
Entry
Pnec_0677         CDS       T00683                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00620  Pyruvate metabolism
pne00630  Glyoxylate and dicarboxylate metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnec_0677
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0677
Enzymes [BR:pne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pnec_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACB43913
UniProt: B1XU86
Position
588492..588779
Genome map
AA seq 95 aa AA seqDB search
MTARTTCNSLQVATPLYRFIEDKVLPGTGIKSADFWKGFDEIVKDLTPKNEALLAKRDRI
QADLDKWHQANPGPIKDMPAYRQFLKQIDYLVINP
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcgtactacttgcaatagccttcaagtggcaacccctttgtatcgctttatc
gaagataaagtgcttccaggtaccggcattaaaagtgctgatttttggaagggctttgat
gaaattgttaaagacttaaccccaaaaaatgaggctttgcttgctaagcgcgatcgcatt
caggcggacttggataaatggcatcaagccaatccaggaccaatcaaagacatgcctgca
tatcgtcagtttttgaagcagatcgattacctagttattaacccatag

DBGET integrated database retrieval system