KEGG   Polynucleobacter necessarius: Pnec_0819Help
Entry
Pnec_0819         CDS       T00683                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00010  Glycolysis / Gluconeogenesis
pne00051  Fructose and mannose metabolism
pne00562  Inositol phosphate metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
pne01230  Biosynthesis of amino acids
Module
pne_M00002  Glycolysis, core module involving three-carbon compounds
pne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnec_0819
   00051 Fructose and mannose metabolism
    Pnec_0819
   00562 Inositol phosphate metabolism
    Pnec_0819
Enzymes [BR:pne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pnec_0819
Exosome [BR:pne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pnec_0819
  Exosomal proteins of bladder cancer cells
   Pnec_0819
  Exosomal proteins of melanoma cells
   Pnec_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB44023
UniProt: B1XUJ6
Position
705191..705949
Genome map
AA seq 252 aa AA seqDB search
MRPLIVIGNWKMNGSLANNQDWVKTVARGMESGMPSGRKYAVCPPFPYLQQCADLIKGHS
LAFLSLGAQDASAYGSGVYTGEVAAAMLKEFGCTCVIVGHSERRQMHQEVDEVIASKALQ
VLDNSMTPVICVGETADERNSGRAQEIVCSQVAKQVGVLQDRLVDCLIAYEPVWAIGTGK
VASAQVAQDMHRAIRLQLAEFNEDVASHVGILYGGSVKPDNAVELFAMPDIDGGLVGGAS
LSPQDFLAICKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccactcatcgtaatcggcaactggaaaatgaacggcagtcttgcaaataatcaa
gactgggttaagactgttgctcgcggcatggagagtggtatgccatctggtcgtaaatat
gcagtttgccctccttttccatacttgcaacaatgtgctgacttaattaaaggacattcg
ttggcgttcttaagtttgggtgctcaggatgcttcggcctatggctctggggtctacacc
ggagaggtggcagcagcaatgctgaaggagtttggctgcacttgcgtcatcgtaggccat
tcagagcgccgtcaaatgcatcaagaagttgatgaggtgattgcgtctaaagcgcttcaa
gttttggacaatagcatgacaccagtaatttgtgttggtgaaacggctgatgagaggaat
tctggtagagcccaagagattgtttgctctcaggttgcaaagcaagtaggcgttttgcag
gatcgtctggttgactgcctaattgcctatgagcctgtatgggcgataggcaccggtaaa
gtggctagcgctcaagttgcacaagacatgcatcgcgctattcgcttgcaattggctgaa
tttaatgaggacgtagcgtctcatgtaggaattttgtatggcggcagtgtcaaacctgat
aatgccgttgaattgtttgccatgcctgatattgatggcggattggttgggggtgcttca
ctgagtcctcaagactttctagccatctgcaaggcatag

DBGET integrated database retrieval system