KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0819Help
Entry
Pnec_0819         CDS       T00683                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnec_0819 (tpiA)
   01230 Biosynthesis of amino acids
    Pnec_0819 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnec_0819 (tpiA)
   00051 Fructose and mannose metabolism
    Pnec_0819 (tpiA)
   00562 Inositol phosphate metabolism
    Pnec_0819 (tpiA)
Enzymes [BR:pne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pnec_0819 (tpiA)
Exosome [BR:pne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pnec_0819 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pnec_0819 (tpiA)
  Exosomal proteins of melanoma cells
   Pnec_0819 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
705191..705949
Genome map
AA seq 252 aa AA seqDB search
MRPLIVIGNWKMNGSLANNQDWVKTVARGMESGMPSGRKYAVCPPFPYLQQCADLIKGHS
LAFLSLGAQDASAYGSGVYTGEVAAAMLKEFGCTCVIVGHSERRQMHQEVDEVIASKALQ
VLDNSMTPVICVGETADERNSGRAQEIVCSQVAKQVGVLQDRLVDCLIAYEPVWAIGTGK
VASAQVAQDMHRAIRLQLAEFNEDVASHVGILYGGSVKPDNAVELFAMPDIDGGLVGGAS
LSPQDFLAICKA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccactcatcgtaatcggcaactggaaaatgaacggcagtcttgcaaataatcaa
gactgggttaagactgttgctcgcggcatggagagtggtatgccatctggtcgtaaatat
gcagtttgccctccttttccatacttgcaacaatgtgctgacttaattaaaggacattcg
ttggcgttcttaagtttgggtgctcaggatgcttcggcctatggctctggggtctacacc
ggagaggtggcagcagcaatgctgaaggagtttggctgcacttgcgtcatcgtaggccat
tcagagcgccgtcaaatgcatcaagaagttgatgaggtgattgcgtctaaagcgcttcaa
gttttggacaatagcatgacaccagtaatttgtgttggtgaaacggctgatgagaggaat
tctggtagagcccaagagattgtttgctctcaggttgcaaagcaagtaggcgttttgcag
gatcgtctggttgactgcctaattgcctatgagcctgtatgggcgataggcaccggtaaa
gtggctagcgctcaagttgcacaagacatgcatcgcgctattcgcttgcaattggctgaa
tttaatgaggacgtagcgtctcatgtaggaattttgtatggcggcagtgtcaaacctgat
aatgccgttgaattgtttgccatgcctgatattgatggcggattggttgggggtgcttca
ctgagtcctcaagactttctagccatctgcaaggcatag

DBGET integrated database retrieval system