KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0904Help
Entry
Pnec_0904         CDS       T00683                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pnec_0904
Enzymes [BR:pne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pnec_0904
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pnec_0904
Lipid biosynthesis proteins [BR:pne01004]
 Fatty acid synthase
  Component type
   Pnec_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
776599..776841
Genome map
AA seq 80 aa AA seqDB search
MQIPPNYGWEYTKQFKDLFSKLASQENVQLLPFFLDGVTSDSSLFQTDRIHPNEKRNPCS
LKTYGALWPHMKYCLRVINA
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcccgcctaattatggatgggaatataccaagcagtttaaagacctattttca
aaattggcatctcaagagaatgtgcaattactccctttttttctagatggtgttacctct
gactcgagcttatttcagaccgatcgcattcatccgaatgaaaagcgcaatccatgctct
ttaaaaacgtatggggcgctatggccccatatgaagtattgtttaagagtaattaatgct
taa

DBGET integrated database retrieval system