KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1048Help
Entry
Pnec_1048         CDS       T00683                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnec_1048 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnec_1048 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnec_1048 (trpA)
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnec_1048 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(911117..911914)
Genome map
AA seq 265 aa AA seqDB search
MSKITALFKELKATGKKGLIPFIAAGDPDPKQTVELMHALVRGGSSVIELGVPFSDPMAD
GPVIQRLSERALTHGVTLHSCLEMVKEFRKKDANTPVVLMGYANPVEQMGAERFATEAKA
AGVDGVLVVDCPPEECVDFAARMRVAGIDPIFLLAPTSSQERIKGAAKIASGYIYYVSMR
GVTGASHLNTQDVASIIPKIREETDIPIAVGFGISDAASAKAVSTSADAVVIGSQIIRLL
EDAPSGQAVQSLETFIREIRDALDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattactgcgctcttcaaggagctaaaagcaacgggtaaaaaaggattgatt
ccttttattgctgcaggcgatcctgatcccaagcaaacggttgaattaatgcatgcatta
gtgcgcggcggctcaagtgtgattgaattaggcgtgcctttttcagatcccatggctgat
ggtcctgtcattcaacgattatctgagcgagcattaacgcatggcgtcactttgcacagt
tgtttggaaatggtgaaagagtttcgtaagaaagatgccaacacaccagtggtcttgatg
ggatacgcaaatccagtggagcaaatgggagcggaacgtttcgctacagaagcaaaggct
gctggcgttgatggtgttctagtggtggattgtccaccggaagagtgcgttgattttgca
gctcgcatgcgcgttgctggaattgatccgattttcttgttggcacccacttcatcacag
gagcgtattaaaggggctgccaaaatagcgtctggttatatttattacgtttcgatgcgt
ggcgttacgggcgcttctcaccttaatacccaggatgtggcaagcatcatcccgaaaata
cgagaagaaaccgatattccgatcgcggtaggctttggaattagcgatgccgctagcgcc
aaggcggtgtctaccagcgctgatgccgtggtgattggtagccaaattattcgccttttg
gaggatgcaccctctgggcaggcagtacaatcactggaaaccttcattcgtgagattcgc
gacgcattggatagttaa

DBGET integrated database retrieval system