KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1048Help
Entry
Pnec_1048         CDS       T00683                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
pne00260  Glycine, serine and threonine metabolism
pne00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01130  Biosynthesis of antibiotics
pne01230  Biosynthesis of amino acids
Module
pne_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnec_1048
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnec_1048
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnec_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Peripla_BP_6 PcrB FlpD DUF561 PI-PLC-X GCH_III
Motif
Other DBs
NCBI-ProteinID: ACB44223
UniProt: B1XV46
Position
complement(911117..911914)
Genome map
AA seq 265 aa AA seqDB search
MSKITALFKELKATGKKGLIPFIAAGDPDPKQTVELMHALVRGGSSVIELGVPFSDPMAD
GPVIQRLSERALTHGVTLHSCLEMVKEFRKKDANTPVVLMGYANPVEQMGAERFATEAKA
AGVDGVLVVDCPPEECVDFAARMRVAGIDPIFLLAPTSSQERIKGAAKIASGYIYYVSMR
GVTGASHLNTQDVASIIPKIREETDIPIAVGFGISDAASAKAVSTSADAVVIGSQIIRLL
EDAPSGQAVQSLETFIREIRDALDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattactgcgctcttcaaggagctaaaagcaacgggtaaaaaaggattgatt
ccttttattgctgcaggcgatcctgatcccaagcaaacggttgaattaatgcatgcatta
gtgcgcggcggctcaagtgtgattgaattaggcgtgcctttttcagatcccatggctgat
ggtcctgtcattcaacgattatctgagcgagcattaacgcatggcgtcactttgcacagt
tgtttggaaatggtgaaagagtttcgtaagaaagatgccaacacaccagtggtcttgatg
ggatacgcaaatccagtggagcaaatgggagcggaacgtttcgctacagaagcaaaggct
gctggcgttgatggtgttctagtggtggattgtccaccggaagagtgcgttgattttgca
gctcgcatgcgcgttgctggaattgatccgattttcttgttggcacccacttcatcacag
gagcgtattaaaggggctgccaaaatagcgtctggttatatttattacgtttcgatgcgt
ggcgttacgggcgcttctcaccttaatacccaggatgtggcaagcatcatcccgaaaata
cgagaagaaaccgatattccgatcgcggtaggctttggaattagcgatgccgctagcgcc
aaggcggtgtctaccagcgctgatgccgtggtgattggtagccaaattattcgccttttg
gaggatgcaccctctgggcaggcagtacaatcactggaaaccttcattcgtgagattcgc
gacgcattggatagttaa

DBGET integrated database retrieval system