KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1049Help
Entry
Pnec_1049         CDS       T00683                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnec_1049
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnec_1049
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnec_1049
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnec_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(911935..913128)
Genome map
AA seq 397 aa AA seqDB search
MYDKPDARGHFGPYGGVFVSETLMYALDELKEAYAKYQHDPEFIEEFHYELKHFVGRPSP
VYHAKRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQHGV
ATATICARFGLDCTVYQGSVDVARQAQNVFRMRLLGAKVVPVESGTKTLKDALNEAMRDW
VTNVDNTFYIIGTVAGPHPYPMMVRDFQSVIGEECKAQMPEMTGRQPDYVLACVGGGSNA
MGIFYPYIDFPEVKLVGVEAAGHGLGSGLHSAALCVGKPGVLHGNRTYLLQDENGQISET
HSVSAGMDYPGVGPEHAWLKDSGRADYVAITDEEALQAFHDCCRIEGIIPALESSHAIAY
VCKLAKTLPKDKTILVNLSGRGDKDMHTVAQATGSEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgataagccagatgcacgaggacactttggtccctatggtggcgtatttgtttct
gagacattgatgtatgcattagatgaactcaaagaggcctatgcaaaatatcaacacgat
ccagaattcattgaagagtttcattacgaactcaaacactttgtcggcagaccatcaccg
gtttatcacgcgaagcgttggagtgaaatgctcggtggcgcgcagatctatctcaagcgt
gaagacttaaaccacactggcgctcacaaaattaataacgtgattggtcaagcaatgctg
gccaagcgcatgggtaaaccccgcatcattgcagagacaggcgctggtcagcatggggtt
gctacagcaaccatctgcgcacgttttggtttggattgcacggtatatcaagggtctgtt
gacgttgctcgtcaagcgcaaaacgtatttcgcatgaggttacttggcgccaaagttgtt
cccgtggaatctggcaccaaaactttaaaagatgcgctgaacgaagcaatgcgcgattgg
gtaacgaacgtagacaacactttctacattattggcactgttgcagggccgcatccatat
ccaatgatggtgcgcgatttccaaagtgtgattggtgaagagtgcaaggcacaaatgcca
gagatgactggtcgtcaacctgactatgttttggcttgtgttggtggtggctctaatgcg
atgggtattttctatccgtatattgatttccctgaagtgaaattggtgggagttgaagca
gcaggtcatggtctaggtagtggtttgcattcagcagcgctctgtgttggtaagccaggc
gtattgcacggcaaccgtacttacttattgcaagacgagaatggccagatctctgagacc
cattctgtttctgctggcatggattatccaggcgttggacctgagcatgcttggttaaaa
gattctggccgcgcggactatgtggcgattacagatgaagaggcgttgcaggcattccat
gattgttgccgcattgaaggcatcattccagcgctggagtcctctcacgcgattgcttat
gtctgcaaacttgctaagaccttgccaaaagacaagactatattggttaatttgtctggt
cgcggggataaagatatgcataccgttgcccaagcaacgggatcagaaggctaa

DBGET integrated database retrieval system