KEGG   Polynucleobacter necessarius: Pnec_1087Help
Entry
Pnec_1087         CDS       T00683                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00010  Glycolysis / Gluconeogenesis
pne00020  Citrate cycle (TCA cycle)
pne00620  Pyruvate metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
Module
pne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnec_1087
   00020 Citrate cycle (TCA cycle)
    Pnec_1087
   00620 Pyruvate metabolism
    Pnec_1087
Enzymes [BR:pne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pnec_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N Hamartin
Motif
Other DBs
NCBI-ProteinID: ACB44261
UniProt: B1XV84
Position
complement(943610..944905)
Genome map
AA seq 431 aa AA seqDB search
MSQIIEIKVPDIGDYKDVPVIEVLVKAGDKIEKEQSIVVLESDKATMDVPSSHSGVAKEV
RVKVGDNLSEGSVVVVLEGGASGASTPVSTPAAAPTAPAAKVVEPPIARALAPPPISNTP
PPVDTAVSHASPSVRKFARELGATVAQVKGSGPKGRITQEDVQAFVKAAMSGGAGSPAAA
SIGGSLGGLNLIPWPKVDFTKFGEIERQPLNRIKKLTAANLGRNWVMIPAVTYHEDADIT
DLEAFRILTNKENEKRGIKITMLAFLMKAAVAALKKYPEFNSSLDGDDLILKKYFNIGFA
ADTPTGLVVPVIKDADKKGIFELAKETSDLATLARDGKLKPDQMQGASFTISSLGGIGGT
YFSPIVNAPEVAIMGVSKASMKPVWDGKQFVPRLICPLSLSADHRVIDGALATRFNVYIA
QLLADFRRASL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaataattgaaatcaaagtcccggatatcggtgactacaaagatgtgccggta
atcgaagtcttggtgaaggctggagacaagattgaaaaagagcaatccattgttgtttta
gagtctgacaaagccacgatggatgttccttcttcacactctggtgtagcgaaagaagtc
agagttaaagtaggcgataacctctctgaaggatcggttgttgtggtcttggagggtggg
gcatctggtgcatcgactcctgtttcgacacctgcggctgctcccacggcgccagcggca
aaggtggttgagcctccgattgcaagagcgctagcaccacccccaattagcaacactcct
ccgcctgtagacacggccgtgagtcacgcaagcccatctgtgcgcaagtttgcgcgagag
cttggcgcgacagttgctcaagttaaaggctcgggtccaaaaggtcgcattactcaggag
gacgttcaggcgtttgtcaaagcggctatgagtggcggagcaggtagtcctgcggcagct
tcaattggtggcagtttaggcggcttgaatttgattccttggccaaaagtcgatttcacg
aagtttggtgagatagagcgtcaaccattaaatcgaattaagaaactcactgcagccaac
ttggggcgtaactgggtgatgattccagctgtgacgtatcacgaagacgcagacattact
gacttggaggccttccgcattctcacgaataaagagaatgagaagaggggcattaagatc
acgatgctcgctttcttaatgaaagctgcagttgcggctctgaaaaaatatccagagttc
aatagttctctggatggtgacgacctcatattgaagaaatacttcaatattggttttgca
gcggatacgccaacaggattggttgtgccggtaattaaagatgcggataaaaaaggcatc
ttcgagttggccaaagagacttcagacttagctacattagcacgtgatggcaaattaaaa
ccagatcaaatgcagggtgctagctttacgatctcatctttgggtggtattggtggtacg
tatttctcaccaatcgtcaatgctcctgaagttgccatcatgggtgtgagcaaggcatct
atgaagccagtttgggatggcaagcagtttgtgccacgcctcatttgcccattatcttta
tctgcggatcatcgcgtgattgacggtgccttggctactcgctttaacgtgtacattgct
cagctcttagccgacttccgtcgcgctagtctgtaa

DBGET integrated database retrieval system