KEGG   Polynucleobacter necessarius: Pnec_1232Help
Entry
Pnec_1232         CDS       T00683                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00230  Purine metabolism
pne00240  Pyrimidine metabolism
pne01100  Metabolic pathways
pne03030  DNA replication
pne03430  Mismatch repair
pne03440  Homologous recombination
Module
pne_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pnec_1232
   00240 Pyrimidine metabolism
    Pnec_1232
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pnec_1232
   03430 Mismatch repair
    Pnec_1232
   03440 Homologous recombination
    Pnec_1232
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pnec_1232
DNA replication proteins [BR:pne03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pnec_1232
DNA repair and recombination proteins [BR:pne03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Pnec_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ACB44368
UniProt: B1XVJ1
Position
complement(1064205..1064669)
Genome map
AA seq 154 aa AA seqDB search
MARIDFHSNVSDKLEYACRLARKIWSATPEGEPVRNIVMVGEKADLQKLNDLLWSFSSTD
FLPHCFIEDDAAAETPIVLTDDFASAVLGNLLHADVMIHLGMRMSADVPALVARYPRIVE
VVTVNEAERLAGRERFKAYRDLGHELHNFDQSKS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtattgattttcatagcaacgtaagtgataagctggaatacgcttgtcgctta
gcgcgcaagatttggagtgctacgccggagggcgagccagttcgcaatattgtgatggtg
ggcgagaaggcggatctacaaaaattaaatgatctgctgtggtcatttagcagcactgat
tttttgccacactgttttatcgaggatgatgctgcagcagaaacgcccatcgtcttgacg
gatgattttgcttcagcagtcttgggcaacctccttcatgcggatgtcatgattcaccta
ggcatgcggatgtctgcagatgtgccagcgttagtggcgcgctaccctcgaatcgtggag
gtggtgactgtcaatgaagcagagcgtttagcagggcgtgaacgctttaaagcctaccga
gatctgggtcatgaattgcataactttgaccagtctaaaagctag

DBGET integrated database retrieval system