KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1435Help
Entry
Pnec_1435         CDS       T00683                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pnec_1435
   00052 Galactose metabolism
    Pnec_1435
   00500 Starch and sucrose metabolism
    Pnec_1435
   00520 Amino sugar and nucleotide sugar metabolism
    Pnec_1435
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pnec_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1235965..1236849
Genome map
AA seq 294 aa AA seqDB search
MPLSTKAVTKAVFPVAGLGTRFLPATKANPKEMLNVVDKPLIQYAVEEAISAGITEMIFV
TGRSKRAIEDHFDKAYELEAELEAKNKQALLEIVRSVKPSHVDCVYVRQPEVLGLGHAVL
CAEKLVRDEPFAIILADDLLDGQPPVFKQMLKVFEEQNGSVVAVEKIDPAKSSSYGIVSG
AEVAKGIYRLNGIVEKPQPKDAPSNLAVVGRYVLSSDIFTHIRNLKPSAGGEIQLTDAIA
SLLKEEPVFAYEYDGVRYDCGSKLGYLKASVEFALRHPEVSTDFAAYLKSRSLT
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccgttaagcactaaagccgtcaccaaagcagtctttcctgttgcgggcttaggcaca
cgctttttaccagcaacgaaagctaatccaaaggaaatgctgaatgtggtggataagccg
ctcattcaatatgctgttgaagaagctatctccgccggtattaccgaaatgatttttgtc
accggtcgcagtaaacgcgccattgaagatcactttgataaagcatatgaacttgaggcc
gagctagaggccaaaaataaacaggctcttcttgaaatcgttcgcagcgttaagcctagc
cacgtagattgcgtatatgtacgccaacctgaagtgcttggattaggtcatgcggttttg
tgcgcagagaagttggtgcgtgatgagccatttgccatcatcttggccgacgacttgttg
gatggccagcccccggttttcaaacaaatgttaaaagtttttgaagagcaaaatggatcg
gtagttgcggttgaaaagattgaccctgccaagagtagctcttatggaatcgtttctggc
gccgaagtcgccaaaggcatctaccgcctgaacggcattgttgaaaagccacaaccaaag
gacgcaccctctaatttggcggtggtaggacgttatgttctctcatccgatatctttacc
catattcgcaatctcaagcctagtgcaggtggtgagattcaattgactgatgctattgcc
tctttgctcaaagaagagcctgtatttgcctatgagtacgatggcgtgcgctatgactgt
ggcagcaagttgggttacctcaaggcttcagttgagtttgccctgcgccaccctgaagtc
tccactgactttgctgcttaccttaagagccgctcattgacttaa

DBGET integrated database retrieval system