KEGG   Polynucleobacter necessarius: Pnec_1435Help
Entry
Pnec_1435         CDS       T00683                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pne  Polynucleobacter necessarius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pne00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pne00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pne00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pne00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1235965..1236849
Genome map
AA seq 294 aa AA seqDB search
MPLSTKAVTKAVFPVAGLGTRFLPATKANPKEMLNVVDKPLIQYAVEEAISAGITEMIFV
TGRSKRAIEDHFDKAYELEAELEAKNKQALLEIVRSVKPSHVDCVYVRQPEVLGLGHAVL
CAEKLVRDEPFAIILADDLLDGQPPVFKQMLKVFEEQNGSVVAVEKIDPAKSSSYGIVSG
AEVAKGIYRLNGIVEKPQPKDAPSNLAVVGRYVLSSDIFTHIRNLKPSAGGEIQLTDAIA
SLLKEEPVFAYEYDGVRYDCGSKLGYLKASVEFALRHPEVSTDFAAYLKSRSLT
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccgttaagcactaaagccgtcaccaaagcagtctttcctgttgcgggcttaggcaca
cgctttttaccagcaacgaaagctaatccaaaggaaatgctgaatgtggtggataagccg
ctcattcaatatgctgttgaagaagctatctccgccggtattaccgaaatgatttttgtc
accggtcgcagtaaacgcgccattgaagatcactttgataaagcatatgaacttgaggcc
gagctagaggccaaaaataaacaggctcttcttgaaatcgttcgcagcgttaagcctagc
cacgtagattgcgtatatgtacgccaacctgaagtgcttggattaggtcatgcggttttg
tgcgcagagaagttggtgcgtgatgagccatttgccatcatcttggccgacgacttgttg
gatggccagcccccggttttcaaacaaatgttaaaagtttttgaagagcaaaatggatcg
gtagttgcggttgaaaagattgaccctgccaagagtagctcttatggaatcgtttctggc
gccgaagtcgccaaaggcatctaccgcctgaacggcattgttgaaaagccacaaccaaag
gacgcaccctctaatttggcggtggtaggacgttatgttctctcatccgatatctttacc
catattcgcaatctcaagcctagtgcaggtggtgagattcaattgactgatgctattgcc
tctttgctcaaagaagagcctgtatttgcctatgagtacgatggcgtgcgctatgactgt
ggcagcaagttgggttacctcaaggcttcagttgagtttgccctgcgccaccctgaagtc
tccactgactttgctgcttaccttaagagccgctcattgacttaa

DBGET integrated database retrieval system