KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1547Help
Entry
Pnec_1547         CDS       T00683                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
pne00020  Citrate cycle (TCA cycle)
pne00640  Propanoate metabolism
pne00660  C5-Branched dibasic acid metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
Module
pne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnec_1547
   00640 Propanoate metabolism
    Pnec_1547
   00660 C5-Branched dibasic acid metabolism
    Pnec_1547
Enzymes [BR:pne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pnec_1547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A CIDE-N
Motif
Other DBs
NCBI-ProteinID: ACB44629
UniProt: B1XRZ4
Position
complement(1347059..1348228)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKELLRQFNVPVPNGIPAFSVDEAVKAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLAKSMDEVKRYASEILGMQLKTHQTGPEGQKVNRLLIEDGADIKKEYYFSIVTDRGTQK
NVIMASSEGGMDIEEVAESHPEKIIKVFVDPMVGLTDADCDIIAKGIGVPEASIPMARDV
FKNLYKTYWDTDASLVEINPLILEGNGKIKALDAKFNFDPNALFRHPEIVAYRDIDEEDA
AEIEASKFDLTYISLDGNIGCLVNGAGLAMATMDAIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNKNVQAILVNIFGGIMRCDVIADGVVTACKVVNLTVPLVVRMKGTNEELGKKI
LADSGLPIISTDSMTEAATKVVAAVAKNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgagtaccaaggcaaagaacttcttcgccaatttaatgtgcctgttcct
aacggcattcccgcatttagtgttgatgaggcagtcaaagctgctgaaaaactcggcggc
cctgtgtgggttgttaaagcacagattcatgctggtggtcgcggtaaaggcggcggcgtg
aaattggcaaagagcatggatgaagttaagagatatgcttctgaaattttgggcatgcag
ctcaagacgcatcaaactggaccagaaggtcaaaaagttaatcgccttttaatcgaagat
ggcgctgatattaaaaaagagtactacttcagtatcgttacagaccgcggaacacagaag
aacgtgatcatggcttccagcgaaggcggtatggatattgaggaggtagctgaatctcat
ccagaaaaaattatcaaagtatttgttgatccaatggttggtttgacagatgcggattgc
gacattattgctaaaggaattggcgtaccagaggcatccattcctatggcacgagacgta
tttaaaaatctctacaaaacttactgggataccgatgcttcattggttgaaatcaaccca
ttgattcttgagggtaacggcaaaattaaagctttggacgctaagttcaattttgatcca
aacgcattgttccgccacccagaaatcgttgcctaccgcgatatcgacgaagaagatgct
gctgaaatcgaagcttctaaatttgatcttacttacatttctctagatggcaatattggt
tgtttagttaacggtgcgggcttggcgatggccacaatggacgcaattaagttgtttggt
ggcgaaccagcaaacttcttggacgttggtggtggcgctacagctgaaaaagtaactgaa
gcattcaaaatcatgttgaagaacaagaacgttcaagcgattttggtaaatattttcggc
ggcattatgcgttgcgacgtgattgctgatggtgttgttactgcatgtaaagtagtaaat
ctcacagtacctttggttgtgcgtatgaagggtacaaacgaagagctcggcaagaaaatt
cttgcggactctggtttgccaattattagcaccgactcaatgactgaagccgctactaag
gtagttgctgctgttgccaaaaacaaataa

DBGET integrated database retrieval system