KEGG   Polynucleobacter necessarius: Pnec_1624Help
Entry
Pnec_1624         CDS       T00683                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00900  Terpenoid backbone biosynthesis
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnec_1624
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pnec_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACB44698
UniProt: B1XS63
Position
1426668..1427558
Genome map
AA seq 296 aa AA seqDB search
MVNLDSLSLRSPAKLNLFLHIVGRRTDGYHLLQSVFQLIDWCDTLHLKRISENVVRRINP
IPGVAPEHDLVVRAANLLKDFCQFEGGVEINLQKEIPMGAGMGGGSSDAATTLIGLNALW
SLNLSKETLCALGLKLGADVPFFIFGKNAFVEGVGEKMREISLETPDFLVIFPNRGIATA
SIFQDPELTRDHAQITIDGFLTSPLLYQSNDCQAVAMRIYPEVKQALDWITQAVPGSQPR
MSGSGSSVFAVLDSKTDIAKLKNFLQNLPKGWVGRVVRGLNKNPAYNLISFLQIDL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatctcgattctttatctcttcgctcaccagctaagctcaatctttttttgcat
atcgttggtcgcaggactgatggttatcacctgcttcaatctgtctttcaattaatcgat
tggtgcgacacgctgcacttgaaacgtatttctgaaaatgtagtgcggcgaatcaaccca
attcccggagttgcaccagaacacgatctagtggttcgcgcagcaaatttactaaaagat
ttttgccaatttgaaggcggcgttgaaattaacctgcaaaaagaaattccgatgggcgct
ggtatgggcggaggatcttcagacgcagcgactactttgatcggacttaacgccctttgg
agtctcaacctttccaaagaaacgctttgcgccttaggcctaaagctgggagccgatgtt
ccattctttatttttggcaaaaatgcctttgttgagggtgtcggggagaaaatgcgagaa
atctccctcgaaacccctgattttttggtcatatttcccaaccggggaattgcaaccgct
agcatttttcaagacccggaattgacccgagatcacgctcagattacaattgatggcttt
cttacatcgccattattgtatcaatcgaatgattgccaagcggtagcgatgaggatttac
ccagaagtgaagcaagctttggattggattacccaggcagtaccgggctcacagccccgt
atgtcaggctctggaagtagtgtttttgcagtcttagactctaagactgacatcgcaaaa
ctaaaaaattttcttcaaaatcttcctaaagggtgggtaggtcgggttgttcgggggcta
aataaaaaccccgcttacaatttgatttcatttcttcagattgacctgtag

DBGET integrated database retrieval system