KEGG   Polynucleobacter necessarius: Pnec_1653Help
Entry
Pnec_1653         CDS       T00683                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00010  Glycolysis / Gluconeogenesis
pne00260  Glycine, serine and threonine metabolism
pne00680  Methane metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
pne01230  Biosynthesis of amino acids
Module
pne_M00002  Glycolysis, core module involving three-carbon compounds
pne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnec_1653
  Energy metabolism
   00680 Methane metabolism
    Pnec_1653
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnec_1653
Enzymes [BR:pne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pnec_1653
Membrane trafficking [BR:pne04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Pnec_1653
Exosome [BR:pne04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pnec_1653
  Exosomal proteins of melanoma cells
   Pnec_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACB44727
UniProt: B1XS92
Position
1449760..1450449
Genome map
AA seq 229 aa AA seqDB search
MKQLVLIRHGESAWNLENRFTGWADVDLTPKGAEQALAAGENLKKAGYEFDVAYTSVLRR
AIRTLWNVQDTMDLMWLPVVHSWRLNERHYGALTGLNKAETAEKYGDEQVHIWRRSYDVR
PPLLEHEDERHPKNDPRYSKLNSSDIPLGECLKDNVERVLPLWNESIAPALKAGKRVLLV
AHGNSIRSLIKYLDQVSNEDIMEVNVPNGIPLVYELDDDLKPIQHFYLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacttgtccttattcgtcatggtgaatctgcctggaaccttgaaaaccgcttc
actggctgggcggacgttgacttaaccccaaaaggcgcagaacaagccctagcagctggt
gaaaacctcaaaaaagcaggctatgaatttgatgtggcctacacctctgttttaaggcgt
gcaattcgcaccctctggaacgtccaagacaccatggatttaatgtggctgcctgttgtg
cacagttggcgcctcaatgagcgtcattacggcgcccttactgggctcaataaagcagaa
actgccgaaaaatacggagacgagcaagttcacatctggcgtcgctcttacgatgtgcgc
ccacctctactagaacatgaggatgagcgtcatccgaaaaatgatccgcgctactcaaaa
ctaaattcttctgatattccgctgggcgagtgtttaaaagataacgttgagcgtgtattg
ccattgtggaatgaatcaattgcgccggcgctaaaggctggaaaacgtgttctattagta
gcgcatggtaatagcattcgctcattaattaaatatttagatcaagtgtccaatgaggac
atcatggaagtaaatgttcccaacggcattccgcttgtttacgaattagacgatgatctg
aagcccattcaacacttttatttggattaa

DBGET integrated database retrieval system