KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1653Help
Entry
Pnec_1653         CDS       T00683                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnec_1653 (gpmA)
   01230 Biosynthesis of amino acids
    Pnec_1653 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnec_1653 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Pnec_1653 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnec_1653 (gpmA)
Enzymes [BR:pne01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pnec_1653 (gpmA)
Exosome [BR:pne04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pnec_1653 (gpmA)
  Exosomal proteins of melanoma cells
   Pnec_1653 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1449760..1450449
Genome map
AA seq 229 aa AA seqDB search
MKQLVLIRHGESAWNLENRFTGWADVDLTPKGAEQALAAGENLKKAGYEFDVAYTSVLRR
AIRTLWNVQDTMDLMWLPVVHSWRLNERHYGALTGLNKAETAEKYGDEQVHIWRRSYDVR
PPLLEHEDERHPKNDPRYSKLNSSDIPLGECLKDNVERVLPLWNESIAPALKAGKRVLLV
AHGNSIRSLIKYLDQVSNEDIMEVNVPNGIPLVYELDDDLKPIQHFYLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacttgtccttattcgtcatggtgaatctgcctggaaccttgaaaaccgcttc
actggctgggcggacgttgacttaaccccaaaaggcgcagaacaagccctagcagctggt
gaaaacctcaaaaaagcaggctatgaatttgatgtggcctacacctctgttttaaggcgt
gcaattcgcaccctctggaacgtccaagacaccatggatttaatgtggctgcctgttgtg
cacagttggcgcctcaatgagcgtcattacggcgcccttactgggctcaataaagcagaa
actgccgaaaaatacggagacgagcaagttcacatctggcgtcgctcttacgatgtgcgc
ccacctctactagaacatgaggatgagcgtcatccgaaaaatgatccgcgctactcaaaa
ctaaattcttctgatattccgctgggcgagtgtttaaaagataacgttgagcgtgtattg
ccattgtggaatgaatcaattgcgccggcgctaaaggctggaaaacgtgttctattagta
gcgcatggtaatagcattcgctcattaattaaatatttagatcaagtgtccaatgaggac
atcatggaagtaaatgttcccaacggcattccgcttgtttacgaattagacgatgatctg
aagcccattcaacacttttatttggattaa

DBGET integrated database retrieval system