KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_1677Help
Entry
Pnec_1677         CDS       T00683                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pnec_1677
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pnec_1677
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pnec_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1467520..1467975
Genome map
AA seq 151 aa AA seqDB search
MLRNLMNWLFGLFILLSGLQLAYAASNLQAAPLPHLPHLQDEAPQNLCQYQGKVILVVNT
ASFCGFTSQYEGLEKIYTKYKDQGFVVLGFPSNDFGQQEPGSNKDIADFCKNTYEVKFPM
FAKSMVSGNNPNPLFKMLIAKTGTTPKWNFL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcaatctaatgaattggctctttggcttatttatcctcctatctggacttcag
cttgcttatgctgcaagcaacttgcaggccgctcctctcccacaccttccccatctgcag
gatgaagcaccacaaaacctttgccaatatcaaggcaaggtcattttggttgtgaataca
gcgagcttctgcggctttacaagtcaatatgagggtcttgagaagatttataccaaatac
aaagatcagggttttgtggtgctcggctttccatctaatgatttcgggcagcaagaacct
ggaagcaataaagatattgctgatttctgcaaaaatacttacgaagtgaaatttcccatg
ttcgccaaaagcatggtctcaggaaacaatcccaaccctctatttaagatgctgattgcc
aaaactggcacaactccaaaatggaactttttataa

DBGET integrated database retrieval system