KEGG   Polynucleobacter necessarius: Pnec_1777Help
Entry
Pnec_1777         CDS       T00683                                 

Definition
methionyl-tRNA formyltransferase
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
pne  Polynucleobacter necessarius
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pne00670]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:pne00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1548400..1549398)
Genome map
AA seq 332 aa AA seqDB search
MKIVFAGTPEFAAQAVRAIHAAGHEIVLAFTQPDRRAGRGMHLQASPVKEFALQKNIPIL
QPETLRRTSADPQKKAQAEEAYKSLSAIEFDAMVVVAYGLILPQEILDITEKPGRHGSFN
IHASLLPRWRGAAPIQRAIEAGDAKTGVCIMQMDAGLDTGDTVLVVELDIARDETSASLH
DRLAGLGADLIVNALDVLQQGKTMIRSPQAIKGITYAEKILKSEAEIDWTLSAQEIDQRI
RAFNPFPGASSKLNGYAIKLWNSRLADSQAFSMVGGAGDVLEFGRDGAYIQCGEGVLEVL
EMQKPGGKKMAAKACIQPIGAGEKLLHFQLKE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtctttgctggaactccagagtttgccgctcaagcagtgcgcgcaatccat
gctgctggccatgaaattgtcttggcgtttacacagccagatcgtcgtgctggcagggga
atgcatttacaggcaagcccagttaaagagtttgctctgcaaaaaaatattccaatattg
cagccagaaacattaagacgcactagtgcggacccacaaaaaaaagcgcaagccgaggag
gcctacaagagcctttctgcaattgagtttgatgccatggttgtcgttgcttatggacta
attttgccccaagaaattttggacattaccgaaaagcctggacggcatgggagttttaat
attcacgcctcattgctgcctcgttggcgcggtgctgcgccgattcagcgtgcaatcgaa
gcgggtgatgccaaaacaggtgtttgcattatgcaaatggacgcggggcttgatactggc
gatacggtcctggttgttgaacttgatattgctcgagatgaaacaagcgcaagcctgcat
gatcggttggcggggcttggcgctgacttgattgtgaatgctttggatgtcttgcagcaa
ggcaagaccatgattcgatcgccgcaagcaattaaaggtattacttatgctgaaaaaata
ctcaagagtgaggcggagattgactggacattaagcgcccaagaaattgatcaacgtatt
cgtgccttcaatcctttccccggcgcaagtagcaagctcaatggttacgcaatcaagctt
tggaactcaaggcttgccgattctcaggctttcagtatggttggtggggcgggtgatgtt
ctggaatttggtagagacggcgcatatattcagtgtggcgagggggttctcgaggtttta
gaaatgcaaaaacctggcggcaaaaaaatggctgctaaggcttgcatacagccgattggc
gccggtgaaaaactgttgcactttcagttaaaggagtag

DBGET integrated database retrieval system