KEGG   Phaeosphaeria nodorum: SNOG_00156Help
Entry
SNOG_00156        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SNOG_00156
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SNOG_00156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 862 aa AA seqDB search
MMPGPHGPPSAIRHAPGTQAGASRTTTTSRPQTHSPVHHNPYAQYHHPQHYGPPYGYPQH
MQQMPQWNPYHQPQAQYVMPPRQFQPHASPVVVSSHPHMPIPPVNRAMGQTPPIVHSHTP
PVQRMHTPQPAPSTPSAHSQTYMSAYNTSDEQHVESKPAQGTPPTPVQTTVRKSFYPPLP
WLSVPGPFPPRAAGRRRRRRAPVAAEEEGLALPSREQAVEDDVAESTGEVDDGDQTPTEE
PTESLASTAALPSDAEVDTPSTSHPPSEVDLAHVTTPSAVSQQAPPTAPVAKHARTATIP
AIPLIPIKSAKAPSATSTTQKSVKSPAPKTEDTSADVEAEATPKASPPKPSAPKSWAELL
RAKNAPAAAQPAAVASAPPATNGVAATNGPVAPRSNTLADVLASFSVDSEKKVTFLEPRG
LILQVLLFCVPFYDFLDQVAKRAVHSFKSETPLVDALIMFMRDFKLIDSAATVEKLRLRL
KDKELEQYGDPLTPEYVYDVIRRLPRFDNMKRGQQEDAEEFLGFLLAGLHDEAAHIIKSD
KQNQVSNGVTSPSAEQSESVDGGWMEVGAKQKSANTQSSGAIEFETPITKIFGGKLRSEY
KKPGEKASVTLEPYQPLQLDIGEPNINNISDALKNLTRLETLDGAVRGARASTKQVHIES
LPPVLILHLKRFHYDAQGPQKIWKKVGYPLELEIPKEVFPPHKRNSYMTHGAFPRYRLIS
VVYHHGKNASGGHYTVDLRRQEGNEWIRMDDTTLRRIRAEDVAEGGAEEDPKVLAAALEQ
HKNDAGKSKNFFAQIDMEEEEADKGAWSQVNGTEKKENPKKWAGIVNGTATPNSAGKRTP
MPKENVRDNKVAYILFYQRIET
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccggccctcatggcccgccttcggcgatccgccatgcaccagggacgcaggca
ggagcatcccgtactaccaccacatcccgcccacagacacactcgccggtgcaccataac
ccatatgcgcagtaccaccacccccagcactatggccccccctacggctatccacagcac
atgcagcagatgccacaatggaacccttaccatcagccacaggcacagtacgtgatgccg
ccgcgccagttccagcctcacgcgtcgcccgtggtcgtctcttcgcatccccacatgccc
atccccccggttaaccgcgcaatggggcaaacaccgcccattgtgcactctcatacgccg
ccagtccagcgcatgcacacgccccagccggcaccgtcgacaccgtcagcacactctcag
acttatatgtctgcttacaacacctccgacgaacaacacgttgagtcgaagcctgcccag
ggcacgcctccgacgcctgttcaaacgaccgttcgcaagtccttctacccgccacttccc
tggctttctgttcctggcccctttcccccgcgtgctgcgggacgacggagacggaggcgg
gcgcccgtagctgctgaggaggagggcctcgctcttccctctcgtgagcaggcggtcgag
gacgatgtcgcggagtctaccggagaagttgatgacggcgaccagacaccgactgaagag
ccgaccgagtcgctggcttccaccgccgcactcccttccgatgcagaagttgatactcca
tccacatcccaccctccttccgaagtcgacctggcgcatgttacaaccccttctgctgtg
tctcagcaagcgccaccaacagctccggttgcgaagcacgcacgcactgctactattcct
gccatcccgcttattcctatcaagtcggcaaaggcacccagtgcaacttctaccacccag
aaatcggtcaagtcaccagcgcccaagaccgaggacacttcggcagatgttgaggccgag
gcgacacccaaggcatcaccgcccaagccatctgcaccaaagtcatgggccgagctgttg
agggcgaagaatgctcctgctgccgcccaacccgcggcagtagcatcagcacctcctgcc
accaacggcgtagctgctacgaacggtcccgtagctcctcgcagcaacactttagccgat
gttctcgcgtctttttctgtcgactcggagaagaaggttacttttcttgagccccgtggc
cttattcttcaagtccttctcttctgcgtgccattttacgacttcctcgaccaggtcgcg
aagcgcgctgtgcatagcttcaagtccgagacccctctcgtcgacgctttaatcatgttt
atgcgagacttcaagctcatcgactctgctgctaccgttgagaagctccgccttcgtctg
aaagacaaggagctcgagcaatatggcgacccactcacaccggagtatgtctacgacgtc
atccgacgcctgcctcgattcgataacatgaagcgaggacagcaagaggatgctgaggaa
tttctgggtttcctgcttgccgggctacacgatgaagctgcacacatcatcaagagtgac
aagcaaaatcaggtatcaaacggagtaacatcgccttctgcagaacaatcggagtcagtt
gatggcgggtggatggaagtcggtgcaaagcagaagtcagccaacacccaatcttctggc
gcgattgagttcgaaacgcctattaccaagatctttggcggcaaattgcgttccgaatac
aagaaacctggagagaaggcctctgtgacccttgaaccatatcagcctctccaattggac
atcggtgaaccgaacatcaacaacatctcggacgccctgaagaacttgacccgtttggag
acgctcgatggcgctgttcgaggcgctcgtgcttcgaccaagcaagtgcacattgagtcg
cttcctcctgtcctaatactccacctgaagcgattccactacgacgcacaaggaccgcaa
aagatatggaagaaggtcggatacccattggagctcgagattccaaaggaggtgtttccg
ccacacaagcgaaacagctacatgacccatggcgcattcccacgctacaggctgatttcc
gtcgtctaccaccatggcaagaatgcaagtggtgggcactacacagtcgacctccgtcga
caagaaggtaatgagtggatccgcatggatgataccactcttcgccgtattcgcgcagaa
gatgtggccgagggaggtgctgaggaagacccgaaggtactcgctgctgcgctggagcaa
cacaagaatgatgccggcaagagcaagaactttttcgctcaaatcgacatggaagaagaa
gaggcagacaagggagcgtggagccaagtgaatggcacagaaaagaaagaaaatccgaag
aaatgggctggcatcgtcaacggtacagcaacacccaactccgcgggcaagaggacgccg
atgcccaaggagaacgtcagggacaacaaggtggcatacatactgttctaccagcgcatt
gagacttga

DBGET integrated database retrieval system