KEGG   Phaeosphaeria nodorum: SNOG_00174Help
Entry
SNOG_00174        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pno  Phaeosphaeria nodorum
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:pno03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:pno04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 321 aa AA seqDB search
MAENEVDLDSIIDRLLEVRGSRPGKQVQLLETEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVPKLGGSRPTSPGNKKP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaacgaggtagatttggactctatcatagacaggcttctcgaagtcaggggc
agcaggcccggcaagcaggtccagctgctcgagactgagatccgctatctgtgcaccaag
gcacgagaaatcttcatctcacagcctatcctcctcgagcttgaggcaccgataaagatc
tgtggtgacattcatggccagtactacgatctgctccgtttgttcgagtacggcggtttc
ccacccgaggccaactacctcttcctcggcgactacgtagaccgtggcaagcagtcgctc
gagaccatctgcctgctccttgcatacaagatcaagtaccccgagaacttcttcgtcctg
cgtggcaaccacgagtgcgcatcaatcaaccgcatctacggcttctacgacgagtgcaag
cggagatacaacatcaagctatggaagacgttcaccgactgcttcaactgcctgcccatt
gccgcaatcatcgacgagaagatcttcacgatgcacggtggtctgagtcccgacctgaac
tccatggagcagatcaggcgtgtaatgcgaccaactgatattccggattgtggcctactg
tgtgatctcctatggtctgatcctgacaaggacattaccggatggagcgagaacgacaga
ggtgtcagcttcacattcggccccgacgttgtatctcgtttcctacaaaaacacgatatg
gatctcatatgccgtgcccatcaagtcgtggaagacggctacgagttcttctccaagcgt
cagctcgtaacactgttcagcgctcccaactactgtggtgaattcgacaatgcgggtgcg
atgatgagcgttgacgagagcttgttgtgctccttccagatcctgaaacctgccgagaag
aaacaaaagtacgttcccaaacttggcggcagcagaccaacgtctcctggcaacaagaag
ccttag

DBGET integrated database retrieval system