KEGG   Phaeosphaeria nodorum: SNOG_00174Help
Entry
SNOG_00174        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pno  Phaeosphaeria nodorum
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    SNOG_00174
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SNOG_00174
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SNOG_00174
Protein phosphatases and associated proteins [BR:pno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     SNOG_00174
Transcription machinery [BR:pno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     SNOG_00174
Spliceosome [BR:pno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SNOG_00174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 321 aa AA seqDB search
MAENEVDLDSIIDRLLEVRGSRPGKQVQLLETEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVPKLGGSRPTSPGNKKP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaacgaggtagatttggactctatcatagacaggcttctcgaagtcaggggc
agcaggcccggcaagcaggtccagctgctcgagactgagatccgctatctgtgcaccaag
gcacgagaaatcttcatctcacagcctatcctcctcgagcttgaggcaccgataaagatc
tgtggtgacattcatggccagtactacgatctgctccgtttgttcgagtacggcggtttc
ccacccgaggccaactacctcttcctcggcgactacgtagaccgtggcaagcagtcgctc
gagaccatctgcctgctccttgcatacaagatcaagtaccccgagaacttcttcgtcctg
cgtggcaaccacgagtgcgcatcaatcaaccgcatctacggcttctacgacgagtgcaag
cggagatacaacatcaagctatggaagacgttcaccgactgcttcaactgcctgcccatt
gccgcaatcatcgacgagaagatcttcacgatgcacggtggtctgagtcccgacctgaac
tccatggagcagatcaggcgtgtaatgcgaccaactgatattccggattgtggcctactg
tgtgatctcctatggtctgatcctgacaaggacattaccggatggagcgagaacgacaga
ggtgtcagcttcacattcggccccgacgttgtatctcgtttcctacaaaaacacgatatg
gatctcatatgccgtgcccatcaagtcgtggaagacggctacgagttcttctccaagcgt
cagctcgtaacactgttcagcgctcccaactactgtggtgaattcgacaatgcgggtgcg
atgatgagcgttgacgagagcttgttgtgctccttccagatcctgaaacctgccgagaag
aaacaaaagtacgttcccaaacttggcggcagcagaccaacgtctcctggcaacaagaag
ccttag

DBGET integrated database retrieval system