KEGG   Phaeosphaeria nodorum: SNOG_00187Help
Entry
SNOG_00187        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pno  Phaeosphaeria nodorum
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    SNOG_00187
Enzymes [BR:pno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     SNOG_00187
Glycosyltransferases [BR:pno01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   SNOG_00187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 983 aa AA seqDB search
MASRQATNQYLSEKPNTRRSGKSPSRSPARSPARSPARSPASNGRKQQQKVQPKSYASEG
VKDYDILNLPGSDWQLLGLLVVVAAVVRLFRIAQPSSVVFDEVHFGGFATKYIKGKFFMD
VHPPLAKLLITLTGWLGGFDGSFDFKDIGMDYLEPGVPYVAMRLLPAICGVLTIPTMFLT
LKAAGCRTTTAALGAGLVIFDNALVTQSRLILLDSPLIIFTAITALAWTSFTNQHEQGPS
KAFQPSWWFWLAATGVGLGATVSVKWVGLFTIAWVGSLTLVQLWVLLGDTRNVTPRIWFK
HFFARLFCLVVIPVTFYMAMFAIHFVCLVNPGDGDGFMSSEFQATLNSKGMQDVPADVAF
GSRVSLRHWNTQGGYLHSHSHMYPGGSKQQQITLYPHKDENNIWIMENQTLPIMPEDYNG
PNLTSPKAWDDMGPLFIEDGAVVKLYHITTDRRLHSHDVRAPVTEADWQNEVSAYGYDGF
EGDANDMFKIEIVKSHSDGAEAKKRVRTIQTKFRLVHIMTGCVLFSHKVKLPDWGFEQQE
VTCARGGTLPNSIWYIEGNIHPKMDASAEKVNYRNPGFFGKFWELQKVMWKTNAGLTESH
AWDSRPPSWPILGRGINFWGKHNRQIYLLGNPTLIGLFIAIKGLAIIRWQRGFRDYDNVT
FKRFDYEVGMSILGWAFHYFPFYLMARQLFLHHYLPALYFAILALCQMYDFASYRFNGLG
LKKYPAIGQAVAVGFLALSITVFTLYAPLAYGNAWTKSQCNTVKLFSTWDWDCNNFLDSY
EAYSAINTDVAAVATPSSVAPPPPAPPVIPPGEQQQQQQQEPIVAKQEEIVSEQPAVSGP
PQGIPKDLPVVSKEERIEYRDENGRVLDDEEVAALAGKVSFKTRYETRTRVVDAQGNEIY
EGLVDAHGDDPAPPAEQAGVAPPHPDVDGRNPETQVDSDAAEVSELPPTVEVKEDQQKER
SVELENQAGEAKPASEAQAATAE
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccgacaggcaacgaaccagtacctgagcgagaagccgaatacgcgccgctca
ggaaagtcgccctcgcgatcaccagcacgctctccggcacgttcgcccgcaaggtcgcca
gcgtcaaatggacgcaagcaacagcagaaagtgcagcccaagagctacgcatccgaaggg
gtgaaagactatgacatcttaaacctcccgggctcagattggcagttgctgggtctccta
gttgtcgtagcagctgtggtgcgattgttcaggatagctcagcccagtagtgtcgtcttc
gacgaagtccacttcggtggatttgcgaccaagtacatcaagggcaagttcttcatggac
gtgcatcccccactcgcaaagctcctgatcaccctgacgggatggttgggtggatttgat
ggcagtttcgacttcaaggacattggcatggactacttggagcccggtgtcccgtacgtc
gccatgcgtcttcttcccgctatctgtggtgtccttaccattcctaccatgttcttgacg
ctcaaggctgctggttgccgtacaacaactgcagccttgggcgcgggtctcgtcattttt
gacaacgcgcttgttacccagtcccgactgatcctcctcgactctcctctcataatcttc
acggcgatcaccgcgctcgcctggacaagcttcacgaaccaacacgaacagggcccctcc
aaggcattccagccgtcctggtggttttggctggcagccactggtgttggacttggtgca
acagtcagtgttaaatgggtcggtctgttcacgattgcctgggttggcagcttgacgttg
gtgcaactctgggtcttgcttggagacaccaggaacgttacccctcgcatctggttcaag
cacttcttcgcgcgcttgttttgcctcgttgtcattccagtcactttctacatggccatg
ttcgcgatccacttcgtttgtctcgttaaccctggcgacggcgatggcttcatgtcttcc
gagttccaggccacactcaactccaagggcatgcaggatgtcccagccgatgtcgctttt
ggcagccgcgtttcccttcgccactggaacacccaaggtggttacctccactctcacagc
cacatgtatcccggaggcagcaagcagcagcagatcaccctttacccgcacaaggacgag
aacaacatttggatcatggagaaccagaccctgccgatcatgccggaagactacaatggc
cctaacctgactagccccaaggcctgggacgacatgggtcctctcttcatcgaggatggt
gccgtcgtcaagctctaccacatcaccactgaccgccgtcttcattctcacgatgtccgc
gctcctgtcacagaagccgattggcagaatgaggtgtccgcctacggttacgatggcttc
gaaggtgacgccaatgacatgttcaaaattgaaattgtcaaatcccactccgatggcgca
gaggccaagaagcgtgtccgcaccattcagactaagttcaggcttgtacatatcatgact
ggctgtgtcttattttcgcacaaagtcaagttgcccgactggggtttcgagcaacaagaa
gtcacgtgcgcgcgtggcggcacactcccgaacagtatttggtacatcgaaggcaacatc
catccaaagatggacgcatccgctgaaaaggtcaactaccgtaacccaggcttctttggc
aagttctgggagttgcaaaaggttatgtggaagacaaacgctggacttacagaatctcac
gcctgggactcccgcccaccctcctggcctattcttggtcgcggaatcaatttctggggc
aaacacaaccgacagatctatttactgggcaatccaacgctcattggcctctttatcgcc
atcaaaggtctcgcaattatcagatggcagcgtgggttccgcgactatgataatgtcacc
ttcaagcgtttcgattacgaagtcggcatgagtattcttggttgggcattccactacttc
ccattctacctgatggcgaggcaactgttcctccatcactacttaccagcgctctatttt
gccattctcgcactatgccagatgtacgattttgcaagctatcgattcaacggcctgggc
ctgaagaagtaccctgccatcggtcaggctgttgccgtcggtttcctcgctctttccatc
acagtattcaccctctatgcacctctcgcatacggaaacgcatggaccaagagccagtgc
aatactgtcaagctgttcagcacctgggactgggattgcaacaactttctagactcgtac
gaagcatacagtgcaatcaacaccgatgtcgccgccgttgctacaccatcatctgtagct
cctccgccacctgccccgccagttattcccccgggcgagcagcagcagcagcagcagcag
gagcccatcgtggcaaagcaagaggagatcgtgtctgagcagcctgctgtttcaggcccg
ccccaaggcatcccgaaagacctgccggtcgtttcaaaagaagaacgcatcgaataccga
gacgagaacggccgcgtcctcgatgacgaagaggtggcagcactcgccggaaaagtcagc
ttcaagacccgttacgagacccgcactcgtgtcgtcgatgcgcaaggtaatgagatatac
gaggggcttgtcgacgcacatggcgatgacccagctccaccagctgaacaagctggcgtt
gcacccccgcacccagatgttgacggccgaaaccccgagacccaggtcgacagcgatgcg
gcggaagtcagcgaattgccgcccacagttgaggtcaaggaggatcagcaaaaggagagg
agcgttgagctggagaaccaggctggggaggctaagccggctagcgaagctcaggctgcc
acggcagagtaa

DBGET integrated database retrieval system