KEGG   Parastagonospora nodorum: SNOG_00356Help
Entry
SNOG_00356        CDS       T01161                                 

Gene name
SNOG_00357
Definition
(RefSeq) hypothetical protein
  KO
K07204  
regulatory associated protein of mTOR
Organism
pno  Parastagonospora nodorum
Pathway
Autophagy - other
Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:pno00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    SNOG_00356 (SNOG_00357)
   04136 Autophagy - other eukaryotes
    SNOG_00356 (SNOG_00357)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 1355 aa AA seqDB search
MRPSDDLPLRNGHPHPNPLASHATVHAGANNMALDAPAIQESNGTSSSRPGTAATSRSIS
RVLRDEQAGAAQGASTGTSGRPGMLRAKSDFGPRPPAPPTESADEGSVDGHFTIRHGWAD
QLGSEEYSNLLTSVCESLGPQMNFFMYYTDKKHETGGHPKGENSPFPVQEWRMRDRLKTV
SAVLALCLNIGVDPPDVIKTNPCAKEECWIDPTVTSQTPGHTPMNQIGKALQTQYEQLSM
RTRYKLLLDPTTEETRKYTSTLRRNARNERVLFHYNGHGVPKPTSSGEIWVFNRNYTQYI
PLSLYDLQTWIGAPSLFVYDCSDAGLIISNFNKRSLYPTNPELPADIFTSCLTDPITMAV
QFFILQDPLPTNVSLRDAHNIPGKVSERRTPIGELNWIFTAITDTIAWNSLSKPLFKKLF
RQDLMVAALFRNYLLAQRIMRVYHCHPVSHPEIPQTHDHPLWRSWDLAVELILAQLPDLQ
AEARGEKEYVYKHSEFFSEQLTAFEVYLTQGAVEQKIPEQLPIVLQVLLSQVHRLRALIL
LSSFLDHGPWAVNLALSIGIFPYVLKLLQSQANELKPVMVFIWARILAVDQSCQADLLKD
NGYQYFINIFNPNSGIEHRAMCAFIISMFCKDYNQGQRASLSTELVESCLDHLKDMQNPL
LRQWSCLCLSKLWVNFEEAKWVGIRCMAHERLCELIVDPVAEVRAAMLHALASFLGIRDV
TAQVANIEESIASMVLVVTMDGNSMVRRELLMFFSVFVARYKSRFLVAAYEQFLAEKSSA
TPAQTEDKQGDALFMKSRTSSDPEVPAPAPGLCSQNTIYSAIWKELLVMSVDPHPEIAKE
AGIVVDHILLALSESSLAKHVQSHFEEAVKEVQAARPIRRTAEDASYQQKSSHPPTPTKD
SSYLSLFGSIRKSTSVGASLKNLWTSHEPATSPQKQSSRNKEESAATAPESRPQTPEKYH
VEEEPKSRGFRPRDLSQKPEIPLKSVFFEWSVEYFREPQMKPTEADEPGSTDYNGRLWRR
NRNDKIIAETQPLKEVSVSNRWDVPRGYFDNLSQPMKMCFHQFEDHLVVTDNRDTINIID
YSKSVVRKNCFSNGNPPDSRITDVRFINEDDQALLMTGSSDGVIKIFRNYDSKGRTELVT
GFRALTDLVSSNKNAGLVFDWQQGRGLVLVAGDVKVIRVWNAGTEVCTSVSYQVEGDVFV
AGFGDGAIRVYDQRQKPATAMVKVWKEHKQWVTNVHLQRGGQRELVSGCRSGEVKLWDIP
DKCSGTQKHRVKIFNINSGQPVSYFEPYSGFLRDRSAPIAATAFHPHRLMIAASALHDNH
VNIFACHEPKHSAIKTVKLWEGPTTTPGRVSSLNV
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atgagaccctccgacgacctgcccctccgcaacggccatccacaccccaatccgttggcc
tcacatgcgaccgtccacgccggagcaaacaacatggctctagatgcgccggcaatccaa
gagtccaacggcacatcatcctcgcgccctggcaccgccgcgaccagcagatcaatcagc
agggtccttcgagatgaacaagctggagctgcccagggtgcttcgactggcacctctggc
cggccaggcatgctgcgcgcaaaaagcgacttcgggccccgccctcctgcgccgccaaca
gagagtgccgacgagggcagcgttgacgggcatttcaccattcgccatggttgggccgac
cagctgggctcggaggagtactcgaacttattgacatctgtgtgtgaatctctaggacca
cagatgaacttcttcatgtactacacagacaagaaacacgagacaggcggccaccccaaa
ggcgagaacagcccattccccgtccaagaatggcgcatgagagacaggctgaagactgtt
tctgccgtccttgcgctgtgcctcaacattggtgtggaccctccggatgtcatcaagacc
aacccatgcgcgaaggaagagtgctggatagatccaaccgtaacctcccagacgcccgga
cacactcccatgaaccaaatcgggaaagctctccagacgcagtacgagcagcttagcatg
cgcactcgctacaagctgctcctcgaccctaccacagaagagacgaggaaatacacatcc
acgctaagacgcaatgcgcggaacgagagggtgctgttccactacaatggccatggcgta
cccaagccgacgagttcaggcgaaatatgggtgttcaaccgcaactatacgcagtacatt
ccgctgtccctctatgacttgcagacttggattggagctcccagcctctttgtttacgat
tgctccgatgccggtctcatcatcagcaatttcaacaaaaggagtctctaccccaccaac
cccgagctgccggcagatatcttcacctcatgtctgacagatcctataaccatggccgtg
caattcttcatcttgcaagatccactccccaccaatgtcagtctccgagacgcccacaac
atccctggaaaagtctctgagcgtagaacgcccataggcgagctcaattggatcttcacg
gccattactgacaccattgcatggaactcgttgtcaaaacctctcttcaagaaattgttt
cgccaagacctcatggtagccgcactcttccgcaactatcttcttgcacagagaatcatg
cgcgtctaccattgccatcctgtctcacatcccgagatccctcaaacccacgatcatccg
ctctggcgcagctgggatctagctgtcgagctaatacttgcacaacttccagatctccag
gcagaagcgcgtggtgagaaggaatacgtctacaagcattcggagttcttctcggagcag
ctgacagcctttgaggtatacttgacccaaggagcagtggagcagaagatccccgagcaa
cttcccattgtgcttcaagtattacttagccaggtccatcgccttcgtgcgctcattctt
ctttcgagcttcctagatcacggaccatgggctgtgaatctagcgctcagtatcggcata
ttcccgtacgtgctgaagctgctccagtcacaggcgaacgaacttaagccggttatggtc
tttatatgggcccgaattcttgcggttgatcagtcttgccaggctgatttgctcaaagac
aacggatatcaatacttcatcaacatcttcaatcccaattcaggtatcgaacaccgagca
atgtgcgccttcatcatctccatgttttgtaaagactataatcaaggccaacgtgcatca
ctgagcacagaattagtagagagttgcctcgatcatctcaaagacatgcaaaatcctttg
cttaggcaatggtcatgtctttgtttgagcaaactctgggtcaacttcgaagaagccaaa
tgggtgggtattcgctgcatggcccatgagcggctatgcgagcttatagtagatcctgtg
gccgaggtcagagccgcaatgctgcacgctctggcgtctttcttgggcattcgggatgtg
actgctcaagtcgctaacatcgaagagtcaattgcatccatggtccttgtcgttactatg
gatggcaacagtatggtacggcgagaactgctcatgttcttctcggtttttgttgcacgc
tacaagtcacggttccttgttgctgcctatgagcaattcctggccgaaaagagtagtgca
actccagcacaaaccgaagacaaacagggtgatgctctgttcatgaaatcgcggacatca
tcagatcccgaggttccagccccagcaccgggcctttgctcacaaaacactatatactct
gctatctggaaggaattgctggtcatgtctgttgacccacatcccgagatcgccaaggag
gcgggcatcgttgtggaccatatactattagctttgtccgagtcttccctggctaagcac
gtacagtcccacttcgaagaggccgtgaaggaagttcaggctgctcgtccaatccgccgt
actgcggaggacgcatcgtaccagcagaaatcgtcccatcctcccacgccgactaaagac
tctagttatctgtcactatttggtagcatacgcaagtcaacaagcgtcggcgcatcgctg
aagaatctatggacgagtcacgagcccgcaacgtcacctcagaagcagtcttcaagaaac
aaggaagagagcgctgccacagcaccagagtcgagaccgcaaacccccgaaaagtaccac
gtggaagaagagcccaaatcgcggggcttcaggcctcgagacctgtcgcaaaagccagag
ataccattgaaaagtgtgttctttgagtggtcagtggagtacttccgtgagccgcagatg
aagccgacagaggcggacgaacccggtagcacagactataacggcaggttgtggcgtaga
aatcggaacgataagattattgctgagacgcaacctctgaaggaagtctcggtctccaat
cgctgggatgtgcctcgaggctacttcgacaatctcagccagcccatgaagatgtgcttc
caccagttcgaagaccaccttgttgtgacagacaaccgggatactatcaacatcattgat
tactcgaagtccgttgtcaggaagaactgcttctccaatggcaatcctccagactcgaga
atcacagacgttcgcttcattaacgaagatgaccaagctctactaatgacgggctcaagc
gacggtgtcataaagatcttccgcaactacgactccaaagggcgaacggaactggtcact
ggcttcagagcgttgactgatctcgtatctagcaacaagaacgctgggctggtgttcgac
tggcaacagggacggggcttagtattggttgctggtgatgtcaaggttatccgggtttgg
aatgcgggcaccgaagtttgcaccagcgtaagttaccaagtagaaggagacgtttttgtc
gctggatttggtgatggtgccattcgcgtctacgatcagcgccagaagcccgccacggcc
atggtcaaagtatggaaagaacacaagcagtgggtcacgaatgtgcatctgcagcgaggc
ggccagcgcgagctcgtcagtggctgtcggagtggtgaggtcaagctctgggacatccct
gacaagtgtagtggaacacaaaagcatcgcgtcaagatcttcaacatcaatagcggccaa
cccgtctcctactttgagccgtactccggtttcctccgcgaccgatcagctcccattgca
gctaccgcgtttcatccgcatagactcatgatcgctgcttcggctctacacgacaaccat
gtcaacatattcgcctgccacgaaccgaaacattccgcgatcaagacggtcaagctatgg
gaaggccctactaccactcccggcagggtatcatctctgaatgtttaa

DBGET integrated database retrieval system