KEGG   Phaeosphaeria nodorum: SNOG_00453Help
Entry
SNOG_00453        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pno00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 593 aa AA seqDB search
MARPLLANRASSDISGDRDIAEEDALLTGQPTQRAASGPRTWKFWREVGLFVWAVVATAG
IIVLAVVFQKHSDTQNGSANPSGKRNLIFMVSDGMGPTSLSLTRSFMQFQNGLPFGEQLV
IDKHLIGQSRTRSSSSLITDSAAGATAFSCGKKSYNGAISVTPDHEPCGTVLEAAKKAGY
MTGLVVTTRITDATPACFAAHVNMRQEEDLIAQQMVGDYPLGRVVDLMFGGGRCHFLPNS
TAEHSCRADDKDVVALAKKNGYSYVDDRAGFDSLKGGAGLKLPMLGLFADTDIPYEIDRR
NENDIYPSLQEMAETAMKALSEATRDSDKGYFLMIEGSRIDHAGHHNDPAAQVHEVLAYD
AAFNSVLDYIKNEETETVMVSTSDHETGGLATARQLHTTYPEYVWYPSPLANASHSAERM
ALRYNTYLINDPSDSQKQEFIADEIEDGLGIFDAKDDEINGLVKDPATALYQYADMMSRR
SQTGWSTHGHSAADVNIYSSNPKAAMALVGNHENTEVGEFLRNYLEVDVEAVTKELRDKG
THLTVLKAGEQVSWMGKIPEEGQRLDGQNHLASYGGDFKKRGVEHGEDCGCGH
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccccctcctcgccaaccgcgcctcgagcgacatcagcggcgaccgcgacatc
gccgaggaagacgccctgctcaccggccaacccacccaacgcgccgcctcgggcccccga
acctggaaattctggcgcgaagtcggcctcttcgtctgggctgtcgtcgccacagccggc
attatcgtcctcgcagtcgtgttccagaaacacagcgatacgcagaatggcagcgcaaac
ccctcggggaagcgcaacctcatcttcatggtgtcggacggcatgggtccgacgagtctg
agtctgacgaggagcttcatgcagttccagaacgggctgccgtttggcgagcagctggtc
atcgataagcacttgatcgggcagtcgaggacgaggtcgtcttcgtcgctgatcaccgac
tcggcggctggcgcgacggccttctcgtgcgggaagaagagctacaacggtgccatttcg
gtgacgccggaccatgagccgtgcgggacggtgctggaggctgcgaagaaggcgggttac
atgacgggtctggtggtgacgacgaggatcacggatgcgacgcctgcgtgctttgcggcg
cacgtgaatatgcgacaggaggaggatctgattgcgcagcagatggttggagactatccg
ctgggacgagttgtggatctgatgtttggaggcgggaggtgtcactttctgcccaactcg
acggctgagcattcgtgccgtgcagacgacaaggatgtcgtggccctggcgaagaagaac
ggatacagctatgtcgacgaccgcgcgggcttcgacagcttgaagggaggtgctggactc
aagttgcccatgctgggactctttgccgacaccgacatcccgtatgagatcgaccgccgc
aacgagaacgacatctacccgagcttgcaagaaatggcagagacagcgatgaaggctctt
agtgaagccacccgagacagtgataagggctacttcctgatgattgagggctctcgtatt
gaccatgcgggacatcacaatgaccccgctgcccaagtgcacgaagtcctcgcctacgac
gcagccttcaattctgtcctcgactacatcaagaacgaggaaacagagaccgtcatggta
tcaacatcggaccacgaaactggtggtctggcaactgcgcgccagctccacaccacctac
cccgaatacgtatggtacccttcgcccctcgccaacgcctcgcactcggccgaacgcatg
gctctgcgctacaacacatacctcatcaacgacccttccgatagccagaaacaggaattc
atcgccgacgagattgaagacgggcttggtatcttcgacgccaaggacgacgagatcaac
ggcctggtcaaagacccagcaacggccctataccagtacgcagacatgatgtcgcgccgc
agccaaaccggctggtctacccacggccactcagccgccgacgtcaacatctactcctcc
aaccccaaagccgccatggcgctggtcggcaaccacgaaaacaccgaagtcggagagttc
ctgaggaactacctcgaagtggacgtcgaagctgttaccaaggaattgcgcgacaagggc
acgcacttgactgtgctgaaggcaggagaacaagtcagctggatgggcaagatccctgag
gaaggacaaagactcgatggccagaaccatctcgccagctacggcggagacttcaagaag
aggggtgtcgagcacggtgaggattgtggatgtggacactga

DBGET integrated database retrieval system