KEGG   Phaeosphaeria nodorum: SNOG_00508Help
Entry
SNOG_00508        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     SNOG_00508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 616 aa AA seqDB search
MADDMSAAPASASLSNSVGAQPKKVAYFYDSDVGNYAYVAGHPMKPHRIRMAHSLIMNYG
LYSKMEIYRAKPASKYEMTQFHTDEYIEFLHKVTPDNMDNFTKEQSKYNVGDDCPVFDGL
FEFCGISAGGTMEGAARLNRGKCDVAVNWAGGLHHAKKSEASGFCYVNDIVLGIIELLRY
KQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGTGKNYSVNF
PLRDGITDETYRNIFEPVIEAVMTHYGPEAIVLQCGGDSLSGDRLGCFNLSMDGHANCVR
YVKSFGVPVIILGGGGYTMRNVARTWAYETGELVGEKMSKQLPFNDYYEYFAPDYELDVR
PSNMENANSHDYLHKIKSTVIENIRRTGRPSVEAFTNIPNALPRMADSDGEDEDDDLDAD
MNPDVRMTQRQRDEHIERDGELYDESDDEEYKNSLGVRAQPGVKKRRNISDFPNPNAAPA
QDIDALNGMEEINGDSAVSTRQPSAAPASRTQTPAVAEQGADDDGDVDMDEAEVPAATAT
STRSQSPAGVVTPPDSPPAATAAPALAPTSAPTADVSMEGVDEDTKEAIADAKEEGEAER
DTKNVNGEVRTEVAKD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacatgtcggcggccccggcctctgccagcctgagcaatagtgtgggcgca
caacccaagaaagtcgcatacttctacgactcggatgtgggcaactatgcctacgttgca
ggccatcccatgaagcctcatcgcatacgcatggcgcatagtcttattatgaactatggc
ctttacagcaagatggagatctaccgcgcaaaacccgcctccaagtacgaaatgacgcag
ttccacacagacgagtacatagagtttctgcacaaggtcactccagacaacatggacaac
ttcaccaaggagcagagcaaatacaacgtcggagacgattgtcccgtctttgacggcctc
ttcgagttctgcggcatcagcgccggaggtaccatggagggcgcggcgcgtctgaaccgc
ggcaaatgcgacgtcgcagtcaactgggcgggcggactgcatcacgcaaaaaagagcgaa
gctagtggtttctgctatgtcaacgacattgtccttggcatcatcgagcttctgcggtac
aagcagcgcgtcctgtacatcgatatcgacgtgcaccatggagatggtgtggaggaggct
ttctacacgaccgatcgtgtcatgactgtatccttccacaagtacggcgagtacttcccc
ggtaccggtgaactgcgcgacattggtgttggcactggcaagaactattctgtcaacttc
cctctgcgcgacggcataacagacgagacctaccgcaacatcttcgagccagtcatcgag
gcggtcatgacccactacggcccagaagccattgtgctccagtgcggaggcgacagtctc
tcgggcgaccgacttggatgcttcaacttgagcatggacggccatgccaactgcgttcgc
tacgtcaagagcttcggcgtgcctgtcatcatcttgggtggtggtggttacaccatgcgc
aacgttgcccgcacctgggcatacgagacgggtgagcttgtaggggagaagatgtccaag
cagcttcccttcaatgactactacgagtactttgcgcctgactacgagctggatgttcgg
ccatcaaacatggagaacgccaactcgcacgactatctccacaagatcaagtctactgtg
attgagaacattcgaagaacaggcaggccctcggtagaagccttcaccaacattcctaat
gcattgcctcggatggcagactcagatggtgaagacgaggacgacgacctcgacgctgac
atgaacccggatgtgagaatgactcagcgtcagcgagacgaacacatcgagcgcgatggc
gagctgtacgacgaaagcgacgacgaagagtacaagaacagtctcggtgtacgcgctcag
ccaggcgttaagaagcggagaaacatcagcgacttccccaatccaaatgctgcacccgct
caggacatcgacgcgctcaatggcatggaggagatcaatggggatagcgctgtatcgaca
agacagccttcggccgctccagcgtctcgtacacagacacctgccgtggcagagcaaggg
gctgacgatgatggtgatgttgatatggacgaggcagaggtacccgccgctactgcaacc
tcaactcgctctcaatcacctgccggtgtggtcacaccccctgactcaccaccagccgcg
accgctgcaccagcattagctccaacatcagcacccacggcagacgtctcaatggagggc
gttgacgaggacaccaaggaagccatcgccgacgcgaaagaggagggtgaagcggagcgc
gacactaagaacgtcaacggtgaagtgcgcacagaagttgctaaggattag

DBGET integrated database retrieval system