KEGG   Phaeosphaeria nodorum: SNOG_00928Help
Entry
SNOG_00928        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MPIHFDSDDSDVEKIVNYKFPSNPDSLKSQPTSKALGRSLPPPGDFRPKWWLDYTITSQW
DERKPFVPCNHEGTCAEARCRCFMENVTCEKTCRCPPSCNRRFPGCTCAAIPGKRTCALI
KDCLCVKFKRECDADLCGTCGATEILDPVNRYNDELLHHSCANVAIQRGVPKKTLLGKSE
VHGFGLYAGEDIDAHELIGEYAGETLSIGEMQRREIIYTYEKNMYLFKLNKEQDVDATHM
GNKLRFINNANATHSNCASKVVFCNTVFRVALYALTSIKAGSELFFNYNYPEEMTKNFKQ
PKGKIVAVKQVVKQPKKGKMKRAPSFNDSITSSTGGNEADQEESETPERAKDPTPLGLAR
GLERKAGHPSLSFKRPTMKTRTPMEAQKLPTPKSRKMAVKLAILCQKEQAQRDLE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcccatacatttcgattcagatgactcggatgtcgaaaagattgtcaattacaagttc
ccatcaaatcccgatagcttgaagagccagccaacttccaaagcgcttgggcgatcgttg
cccccaccaggagatttcagacccaagtggtggttggattataccattacctctcaatgg
gacgagaggaaacctttcgtcccttgtaatcatgaaggcacttgtgcagaagccaggtgt
cgctgcttcatggagaacgtcacctgcgagaagacgtgcagatgccctccgagctgcaat
cggcgttttccgggctgtacatgcgctgctattcccgggaagcgtacttgcgcgcttatc
aaagactgcctatgcgtcaaatttaagagagagtgcgatgccgatctttgcggaacttgc
ggcgccaccgagattcttgatcctgtcaaccgctacaacgacgagctcctgcaccatagt
tgcgcgaatgttgcaattcagagaggtgtgcccaagaagacgttgctcggcaagtcagag
gtgcatggctttggtctatatgctggcgaagacatagatgcgcatgaactgattggcgaa
tatgctggagaaacgctttccattggagaaatgcaacggcgagaaatcatctacacctac
gaaaagaacatgtacctcttcaagctcaacaaagaacaagatgttgatgcgacacacatg
ggaaacaagctgcggtttatcaataacgcgaacgcaacacattccaattgcgcctccaag
gtcgtgttctgtaacaccgtcttccgcgtagcactgtacgcactcacgagcatcaaggca
gggtcagaattattcttcaactacaactatccggaagaaatgaccaagaacttcaagcaa
cccaaaggcaagatcgtagcagtaaagcaggttgtcaagcagcccaaaaagggcaagatg
aagcgggcaccgtcgttcaacgactccatcacgtcaagtactggaggaaatgaggccgac
caggaagagagcgagactccagagcgcgcgaaggatccaacgcctctaggtctcgcgcgg
ggactagagcgaaaagcgggacacccatccttgtcattcaagagaccgacgatgaagacg
aggacaccaatggaggcgcagaagcttccgacccccaagtctcggaagatggcagtcaag
ctagcgatactgtgccagaaagagcaggcgcagcgcgacctagaatga

DBGET integrated database retrieval system