KEGG   Phaeosphaeria nodorum: SNOG_01947Help
Entry
SNOG_01947        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SNOG_01947
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SNOG_01947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MAKKLWTMLENNPEVMNQLAQSLGLDDTLAFYDVYSLTDLDLLAFIPRPVYALLVIIPLT
PTWKEMRQSEDEDKPEYGGKDEDDPVIWFKQTIGNACGSIGLVHALLNSEASKHIKPGST
LDKIRKDALPKTMWERAKVLEDSDEFEKAHVDAAKLGDTAAPTPQNNVHSGQHFVAFVKA
KDGHLWELEGDRKGPLDRGALKDDEDVLSAAALEKGLGRLIRIESEKGGDLRFSAIALAQ
SLD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaactctggacgatgctcgaaaacaacccagaggtcatgaaccagcttgct
cagtcactgggcttggatgacaccctcgctttctacgacgtctactccctcaccgattta
gaccttctggccttcattccacgtcctgtctacgctctacttgtcattatcccgctcaca
ccaacatggaaagagatgcgacagtcagaagacgaagataagccggaatacggcggcaaa
gatgaagacgacccggtcatctggttcaagcagacgatcggcaatgcgtgtgggagcatc
ggcctcgtccacgccctgctcaacagtgaagcctccaaacacatcaagccaggctcaaca
ctcgacaagatccgcaaagatgcacttccaaagacgatgtgggagcgtgccaaggtccta
gaagattccgatgaattcgaaaaggcacatgtggatgccgccaagttgggcgacacagct
gcgccgacacctcagaataacgtgcacagtggacagcatttcgtcgcgtttgtcaaggcg
aaagatggacatctgtgggagcttgaaggtgaccgcaaaggcccgctcgatcgaggcgcg
ctgaaggacgacgaggatgtgctgagtgcggcggcactggagaagggcttaggaagattg
atcagaatcgagtcggagaagggtggggatcttaggttctcagctatcgcacttgcacag
agcctcgattag

DBGET integrated database retrieval system