KEGG   Parastagonospora nodorum: SNOG_01959Help
Entry
SNOG_01959        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00790  Folate biosynthesis
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SNOG_01959
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SNOG_01959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 5969431
NCBI-ProteinID: XP_001792581
UniProt: Q0V205
Position
Unknown
AA seq 466 aa AA seqDB search
MSRLKPKNLKAYTTYYYQFAVCDSDNTSPVGRTKTTPNADDDVTEVGLAVYSCANFPFGF
FNAYGNSDSVDYVVHLGDYIYEYKNGYYGWGDSIGRIPLPNHEIFSLYDYRKRLATYRTD
LDLVASHQEFPWIDNTYRDGAAELNNTEDSFLKDGGISVDQRKMNAVRAYFEWMPIRQVD
MDDNLRVWRSFQIGKLIDQGRPRGSRRFGRSEYLLSTGRPSPSYDIANDAGRSLMGSRQE
NWMYRTLSESAKRGATWRVVGSQIVFSHIDREAVDQNGHGINVDAWDGYQSNKNRTLNHL
YSNNINNNIFLAGDSHASWVSDLVWLDEKDYDPETGAGSIGVEFAGTAVSSPCPYGENIT
LAKANNYSHLIESTNAELHWQDLYYRGYYELHFTKDKVEANFFGTPKTREKHGWEIPIAN
FTVLNGENKLQRPVGGGVVESGSLKYGKMVPTNLTVDTTNGTWFEW
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggttgaagcccaagaatctgaaagcgtacaccacatactattaccaattcgct
gtctgcgattccgacaacacaagccctgttggtcgcaccaagacgacgccgaatgctgat
gatgatgtcactgaggtcggccttgctgtgtacagctgtgccaactttccattcggcttc
ttcaacgcatatggcaactctgactctgttgattacgtggttcatcttggcgactacatc
tacgagtacaagaatggctactatggatggggagactccatcggccgcatcccgcttcct
aaccacgaaattttcagcttgtacgattaccgtaagaggctcgctacgtaccgcaccgac
ttggacctcgtagctagtcaccaggaattcccgtggatcgacaacacataccgagatggt
gccgcggaacttaacaataccgaggactcctttttgaaagacggcggtatctcggttgac
caaagaaagatgaacgctgtccgagcttacttcgaatggatgcctatccgccaagtcgac
atggacgacaatctccgggtatggcgatctttccaaatcggcaaattaattgaccagggt
cgccctcgaggcagtcgtcgcttcggtcggtcggagtacttactcagtactggaagaccg
tctccgtcgtacgacattgcgaacgacgcaggccgttccttgatgggttctcgtcaagag
aactggatgtaccgcactctctccgaatcggcgaagcgaggtgctacttggcgcgtcgtt
gggtcgcaaatcgtcttttctcacatcgatcgagaggccgttgaccagaatgggcacggt
atcaatgtcgatgcgtgggatggctatcagtcgaacaagaatcgcacgctgaaccacttg
tatagcaacaacatcaacaacaacattttcttggctggagatagccacgcatcgtgggtc
agtgatctcgtctggctggacgagaaagattatgacccagaaactggcgctggcagcatc
ggagtcgagtttgcgggcactgctgtttcttcaccatgcccgtatggcgagaacatcacc
ctggccaaagcaaacaactactctcaccttatcgagagcactaatgccgaactgcattgg
caggatctatactatcgtggatactatgagcttcacttcacaaaggacaaggtagaagcc
aacttcttcggcactcctaaaacccgcgagaagcacggctgggagattcccatcgcaaac
tttactgtcctcaatggcgagaacaagctgcaaaggcccgtgggaggaggtgttgtcgag
agtggaagtttgaagtacggtaagatggtaccgaccaatctcacagttgataccaccaac
ggcacgtggtttgaatggtag

DBGET integrated database retrieval system