KEGG   Phaeosphaeria nodorum: SNOG_01979Help
Entry
SNOG_01979        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
pno  Phaeosphaeria nodorum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SNOG_01979
Enzymes [BR:pno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     SNOG_01979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1307 aa AA seqDB search
MKPFRAPTFVRPDSTNGEPPLKKRRVSSDQHSSSSAAISRKPLVAVKNPAPSQSPPNDSN
GSYYTVLWRKYTTKKNKTWDGDGVLAVVGGIASLTDSDTGKEMGRGACSRPLLPGSALSI
GGKEIEIDGVMEKADYLSGRVFLGTAAAAPTEQLKRVEPAYKAPPAIKAKPKKAGGMFGN
AIAAFEDKEVVPEYKPSASRKQQFKTPLLSNTVLPQRNSSIPQPRHDPNLPNALVMKRPE
SAPKGKQIVDVVVDPVLSKHLRDHQREGVKFLYECVMGMRCEGEGAIMADEMGLGKTLQT
ITLLWTLMKQNPIHESQPIVKKALVVCPAGLVDNWKREFRKWLGNERIGVFVANGKDKKI
TNFTMGKAYNVMIIGYEMLRTVQEELKKGSGVDIVIADEGHRLKTANNKAMLAIQSLNTE
RRIILSGTPLQNDLGEFYTAIDFVNPGLLGQRSAFKRTFEAPILRSRQPEASESELEKGE
ARWKELVSLTSRFMIRRTAEVLSKYLPSKTEHIVFCKPTKAQAEAYRAILSSPFFSVAVG
GNMDMALQLIMVLKKVCNSPSLIKTTKDGEATPSEMLQALLPLVPPHVLNSHASSTKLRL
LDSLVHRIHTTTEEKIVIVSNYTTTLDMIERMLVSLSYTYLRLDGSTPSNKRQALVEKFN
KTPKAASFAFLLSAKSGGVGLNLIGASRIVLFDIDWNPATDLQAMARIHRDGQKLPVKIY
RFLVKGGIDEKIYQRQVMKMGLANAVVDNKASASSFSKDELRDLFRLDEREGCQTHDLLG
CTCECHGAAEVELEPEPVDEEEEEDEDEDDFTTLRPASQVDMDAQESKLKAKRAAKLPKL
RMLMEYRHLDTSILKQSGGNKLDEDELALAVDDDVFLEVLKQPEQRNAATQCRALKTHYH
PDVARLELPTEGSCAEAIDVSAQRRDERRAKGVSYNSIHFTHHIPPITVIMSQKPIFVAT
HPRACSTAFERVFMTRHETLQCVHEPFGDAYYFGPERLAERYEDDAKAREESGYKDSTYR
TIFDRIAKENSEGKRAFIKDMAQYWIPPNGKPATVAPSLANYRRGVGTDTTKLSPVQSRA
HTDAPLYPYNTQGEPGNPTVIPADLLKTYHFTFLIRHPKYSIPSYYRCTIPPLDKMTGFY
NFRPDEAGYEELRRLFDYLRSEGQIGPKFAGRSEEANGTSNGTNGSSSGVEICVIDADDL
LDNPSDMIEAFCKSTGIEWDPKMLIWDTEKDQEIAKEAFEKWKGFHEDALDSTELRQRTH
KKAPKSDDELFAEWKEKYGEEGAKVIRDTVAANVEHYEYLKQFAIKL
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgaagccattccgggctcccacatttgtgcggccagattcgacaaatggcgaaccaccc
ctaaagaagcgcagagtttcctccgaccaacactcgtcgagcagtgcagcgataagccga
aagcccctcgtcgcagtcaagaatcctgcaccgagccagtcaccaccgaacgacagcaat
ggcagctactacaccgtgttgtggcgaaagtacacgaccaagaagaacaagacatgggat
ggcgatggcgtacttgctgtagtgggcggaattgcttcgctcacagacagcgatacggga
aaagaaatgggaagaggtgcctgcagccgaccgctgctacctggctctgcgctgtctata
ggaggcaaggagatcgagatcgatggagtcatggagaaggctgactatttgtccggtcgc
gtgttcctgggaaccgctgcggcagcgccgacggagcaactgaaacgcgtcgaaccggca
tacaaagctccgcctgccattaaggcgaagccgaagaaggcgggcggcatgtttggcaac
gccatcgcagcgtttgaggacaaggaggttgtgccagagtacaagccttcggcttcacgc
aagcaacaattcaagacgccattactatcgaatacggtgctaccccagcgaaattcgtcg
atcccacagccacgccacgacccgaatctacccaatgcgctcgtcatgaagcgacccgag
tccgctcctaagggaaaacaaattgtggacgtcgtagtcgatcctgtgctgagcaagcat
ctgagagaccatcagcgcgagggcgtaaagttcttgtacgaatgtgtcatgggcatgcgg
tgcgagggcgagggcgctatcatggctgatgagatgggcctgggcaagacgttacagacc
atcacgttactgtggacgctgatgaagcaaaatccaatccacgaaagccagccaattgtc
aaaaaagcactggtcgtctgtcctgccggcttggtcgacaattggaagcgcgagttccgc
aaatggctgggtaatgagagaatcggcgttttcgtggccaatggcaaggacaagaagatc
acgaactttaccatgggcaaggcttacaatgtcatgatcatcggttatgagatgcttcgt
actgtgcaagaagagctgaagaaaggcagtggtgttgatattgtcattgccgacgagggc
cacaggctaaagactgcaaacaacaaagcgatgttggcaattcagtcgctcaacaccgaa
cgccgaatcatcctatctggtacgcctttgcaaaacgatctgggcgagttctacactgcc
atcgactttgttaaccctggactgctcggacagcggtccgctttcaaacgcactttcgaa
gcacccatcctgcgaagccgtcaacccgaagcaagcgaatcagagcttgagaaaggtgaa
gcacgctggaaagagctagtgtcactaacaagtcgcttcatgattcgacgcaccgctgag
gtcctcagtaagtacctgccgtccaaaacagaacacattgtcttctgcaagcccaccaaa
gctcaagctgaggcgtaccgcgccattctatcctcgcctttcttctcagttgctgtaggc
ggcaacatggatatggcacttcagcttatcatggtactgaagaaggtctgcaacagtccg
tctttgatcaagaccacaaaagatggcgaggccactccttccgagatgctacaggctttg
ctccctctcgtgccaccccatgtccttaattcgcacgcttccagcaccaagctccgcctc
ctcgacagccttgtacatcgcattcacacgactaccgaagagaaaattgtcatagtctca
aactacacgaccactcttgacatgattgaacgcatgcttgtatcgttgtcgtacacctac
ctgcggctagacggcagcacaccttccaataagcgtcaagctctcgtggagaagttcaac
aaaacaccaaaagcagcttcctttgcctttttgctgtctgccaagtcaggtggtgtcggg
ctcaacctcattggcgcgagtcgcatcgtgctcttcgatattgactggaatcctgccact
gaccttcaagccatggcacgtatccatcgtgatggtcagaagctgcctgtcaagatctac
cgcttccttgtcaaaggtggcatagacgagaagatctaccagcgccaagtcatgaagatg
ggcctggcaaatgctgtggttgataacaaagcttccgcatcttccttctcgaaagacgag
ttgcgcgacctatttcgcctggatgagagagagggctgtcaaacacatgacttgctagga
tgcacttgcgagtgccatggcgcggcggaagtcgaactcgagcctgagccagtagacgaa
gaagaggaggaggacgaagatgaggacgacttcacgaccttacgaccagcgagccaagtc
gacatggacgctcaagaatccaaactcaaagccaaacgcgcggccaagctgccaaagctc
cggatgctgatggaatatcggcatctcgataccagcattttgaagcagagcggtgggaac
aagctcgatgaagatgagctggcgcttgctgtcgacgacgatgtgttccttgaggtgctc
aagcagcctgaacaacgtaacgcagccacgcaatgtcgtgctctcaagactcactaccat
ccagacgttgcgcgactagagctccccactgaggggtcgtgcgccgaggcgattgacgtc
agtgcgcagcgccgcgatgaacgcagggccaaaggcgtctcgtacaattcaatccatttt
acacatcacatccctccaataaccgtaatcatgtcgcaaaaaccaatattcgtagccaca
cacccgcgagcatgctcgacggctttcgagcgggtcttcatgaccagacacgagacgctc
caatgtgtgcacgagcctttcggagatgcatactacttcggaccggagaggctggcggaa
cggtatgaggatgatgcgaaggcgagggaggagagcgggtataaggacagcacgtacagg
acaatttttgatcggattgcgaaggagaattctgagggcaagcgcgccttcatcaaagat
atggcacaatactggataccacccaacggcaagccggcaaccgttgcgccatcgcttgcc
aactaccgccgcggcgttgggacagacacaaccaaactttcgccagtccagtctcgcgcc
catacagacgctccgttgtacccatacaacactcaaggcgagccaggcaaccctaccgtc
atccccgcagatctcctcaaaacctaccacttcacattcctcatccgccatcccaagtac
agcattcccagctactaccgctgcacgatccctccgctggacaaaatgacaggcttctac
aacttccgccccgacgaggctggctacgaagaactccgccgcctattcgactacctccgc
agcgaaggccagatcggacccaaattcgccggccgatcagaagaagccaacggcacctca
aacggcaccaacggtagcagctccggcgttgaaatctgcgtcatcgatgccgacgatctc
ctagacaacccatccgacatgatcgaggcgttctgcaaatccaccggcatcgagtgggac
cccaagatgcttatctgggacaccgagaaggaccaagagattgcgaaggaggcgtttgag
aagtggaaggggttccatgaggatgcgctggatagcactgagttgaggcagaggacgcac
aagaaagcgcccaagagcgacgacgaattgtttgcggagtggaaggagaagtatggcgag
gagggggccaaggtcattcgtgatactgtggcggcgaatgtggagcattatgagtatctg
aagcagtttgctattaagctgtag

DBGET integrated database retrieval system