KEGG   Phaeosphaeria nodorum: SNOG_02006Help
Entry
SNOG_02006        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pno00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1373 aa AA seqDB search
MPFFSSPQALRLRDLQQTSTNFVAMSAQSYDYGGNGFMGAFKKTHSAHPDFANLTLLVFE
AVMEVVCVSLPGYIVARMGQFDAENQKFLANLNTQLFTPFFTKLASQLTADKLSDLAVIP
IIFVVQTLVSYIAAILVSRVCGFKKRASNFLIAMAVFGNSNSLPISLVISLSKTLSGLHW
DKVPGDNDNEVAARGILYLLIFQQLGQLVRWTWGFNVLLAPATSYSEEDGGKSSALENGE
YDDDEAQHLLSDSQSGYYSGDVTSYETSPDISDSGSISDREDVQADSYFATPTNGNVVVP
GNGVVNDQPNGNLVNGHANDSKPYKDSEIPKGIKGWPKRTRNAVHNVSTSISRAFSWFGR
SIFQSLPKWLQQILSKIYRGLARFLSGLWAFMNPPLWAMLVAIIVASVPQLQHLFFSPGS
FVSNSVTRAVNQSGQVAVPLILVVLGANLARNTLPKEDPHAIEDPKMERTLVIASLVSRM
LIPTLLMAPMLALTAKYVPVSILDDPIFIIVCFLLSGAPTALQLAQICQINNVYMGAMSR
ILFQSYVPTMASSNEGSAPGGSTNRSERPELARNITVDDSTSPRSAAKVVTFPDESISPL
IIGKNKDLEQKDYLDLDKTARQYTSSLSRKRLSGRPSIEHLPSYKSQSHDGNPSLSSLLS
DSSADGHHHHDGLLKQVSAWIKHERARRTARKAKRKGSAKVEHEDHESTQDVAESVVETT
KTRGRSGSQSSDGSVALDQLANILEKTLAIKPADTKRKYAHVRKLSTGLKRHSLVTADSD
YFESVDQLVPNCEAILDNSKTMAYTTDTPELEPVTEKSAKKARKEKEAWDTFKFEILRIA
HTLRLKGWRRVPLDLSEQMDVQRLSGALTNAVYVVSPPKDLPSQAEGADGVPKPKNPPPK
LLLRIYGPQVEHLIDRESELKILQRLARKRIGPRLLGTFTNGRFEEFLHAKALTAKELRE
VDTSKQIAKRMRELHEGIDLLREEREAGPFVWQNWDKWVQRCEQVVTWLDQQIKDSDPES
IRNPADKWKKRGLVCGVEWPVFRATVEKYRKWLEEQYGGIEKINERLVFAHNDTQYGNIL
RMVPEGESPLLLPANKHKQLVVIDFEYANANLPGLEFANHFTEWAYNYHDPDYSWRCNTK
YYPTLEEQHRFICSYLLHTPAYRAPGGSASNPSTPHLGPLPTSGSTTALTATAAPNTISE
FMLDSRAPPGEKYSEQEAQRERQTEEEAKRLMAETKLWRLANSAMWVAWGIVQAHVPGLP
DFDAEEKRASGNENAAGLDGATTEMRAEAEAEAEEEKKAGSVSKEKVGETEIANIGAEQD
ADIYKSQDEEEFDYLAYAQDRAMFLWGDAIRMGIVKAEELPAELRARVRTVEY
NT seq 4122 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcttctccagcccacaggcccttcgcctgcgcgacctccagcagacgtccacc
aacttcgtcgcgatgagcgcgcaatcatacgactacggcggcaatggcttcatgggcgct
ttcaagaagacgcacagcgcgcacccggatttcgccaacctcaccttgctggtctttgag
gcggttatggaagtcgtctgcgtgagcttgccaggctacatcgtcgcacgcatggggcaa
ttcgacgccgagaaccagaagttcctcgccaacttgaatacacagctgttcactcctttc
tttacgaagctggcctcgcagctgacagccgataagctatccgaccttgccgtcatcccc
atcatctttgtcgtacaaacactcgtatcctatatcgccgccattctggtgtccagagta
tgcggtttcaagaaacgcgcttccaattttctcatcgccatggctgtctttggcaactcc
aattcactacccatctctctcgttatctcgctctcgaaaacgctatcaggtctccattgg
gacaaagtcccaggtgacaacgacaacgaagtcgctgcgcgtggcatcctatacctgctc
attttccagcaactcggacagctagtacgctggacgtgggggttcaatgtactcctcgca
cccgccacctcatactcggaagaagatggaggaaagagcagcgctttggaaaacggcgaa
tatgatgacgatgaggcccagcacctcttgagtgattcgcaatctggttactattcggga
gatgttacgagctacgaaacgtcaccggacatcagcgactctggttccatctccgatcgt
gaggatgttcaagccgactcttactttgctacgccaacaaacgggaatgttgtcgttcca
gggaacggtgtcgttaatgatcagcccaacggcaacctcgtgaacggacatgcgaatgac
tccaagccatacaaagactctgaaattccaaaaggcatcaagggttggccgaagcgaaca
cgaaatgctgtgcacaacgtttccacctccatctctagggcattttcttggttcgggcgc
agtattttccaatccttgcccaaatggctccagcaaattctatcgaagatctacagagga
ttagcccgcttcctcagcggcttgtgggctttcatgaatccgcctctatgggctatgctg
gtcgctatcattgttgcatcggtgccgcaattgcagcacttattcttcagtccagggtcc
tttgttagcaactcagttacacgagctgtcaatcaaagcgggcaggtagccgttcccttg
attcttgtggtcttaggtgctaacctagcacgcaacacattacccaaggaggacccacac
gcaatagaagacccgaagatggagaggacactcgtcattgcgtctttggtgagtcgcatg
ctcattcccacactcctcatggcgccgatgttggctttgaccgcaaagtacgtccctgtc
agcattctggacgaccccatcttcattatcgtttgtttcctccttagcggtgctccaacg
gcactccagctcgcgcaaatctgccagatcaacaatgtctacatgggagccatgtcgagg
attcttttccagagttatgtccctacaatggcgagctctaatgaggggtccgcgccggga
ggcagcaccaatcgaagtgagcgccccgagctggcaaggaatattaccgtggatgatagc
acgtcaccgcgctcagctgcaaaagtggtcactttccctgacgagagcatctcaccactc
atcattggaaagaacaaagatcttgagcagaaggactatcttgatctcgacaagaccgca
cgccagtatacttccagtctgagccgcaaaaggctctccggcaggccatctattgagcac
ctgccatcttacaagtctcagagccacgatggcaatccttctctttcttctcttctttca
gacagttctgcagacggtcatcaccaccatgatggtcttttgaagcaagtcagtgcttgg
atcaaacatgaacgagcaaggcgcacggcacgaaaagccaagcgaaagggctctgccaaa
gttgagcatgaagaccatgaatctactcaagatgtcgccgaaagcgtcgtagaaactacc
aagactcgaggaagaagtggatctcaatcatccgacggatcagttgctctcgatcagcta
gcaaacatcttggagaaaacattggctatcaagcctgctgacacgaagaggaagtatgct
catgtccgtaagctctcgacaggcttgaagcgtcactctctagtcacggcagactcagat
tacttcgagtctgtagatcagcttgttccaaactgtgaagccatccttgacaattcgaaa
acaatggcgtacactaccgacaccccagagctcgagccagtcactgagaagtctgccaag
aaagcacgcaaagagaaagaagcatgggacacgttcaagtttgagattctacgcatcgcg
catacactacgactgaagggctggcggagagtaccattggatctcagcgagcagatggac
gtacagaggctgagcggcgcattgacgaatgctgtctacgttgtctcgccgcctaaagac
cttccttcgcaagctgagggtgcagatggtgtccccaagcccaaaaacccgccgcccaag
cttctgctccgcatttacggcccacaggtagagcatcttatcgacagagaatccgagctc
aagatcctgcaacgtcttgcacgcaagcgcatcggcccacgtctgctcggcacgttcaca
aatggacgtttcgaggaattcctccatgcaaaggcactcactgcgaaggaactgcgcgag
gtcgatacctcgaagcagattgcgaagcgtatgcgtgagctccacgaaggcattgatctt
ctcagggaagagcgagaggctgggcccttcgtatggcagaattgggacaagtgggtccaa
cgttgtgagcaggtcgtgacatggcttgaccagcaaatcaaggatagcgacccggaatca
atccgaaacccagcagacaagtggaagaagaggggactggtgtgtggcgtggagtggcct
gtcttccgagcaactgtcgagaagtacaggaagtggctcgaggagcaatacggtggcatc
gaaaagatcaacgagcgactggtgtttgcacataacgatacgcaatatggaaacatcctc
cgcatggtcccagagggcgaatcacctctcttgttgccagcaaacaagcacaagcagctc
gtggtcattgatttcgaatacgcaaacgctaatttacctggtcttgagtttgccaaccac
tttaccgagtgggcatataattaccatgatcctgactactcatggcgatgcaacaccaag
tactacccaacgcttgaggagcagcatcgattcatatgctcctacctgctgcacacacct
gcataccgagcacctggaggttccgcttcaaacccatccactccgcatcttggaccgctc
cctacatctggtagcaccactgcactcactgccactgctgcacccaacacaatctcggaa
ttcatgcttgactcccgtgcaccgcctggggagaagtactccgagcaagaggctcaacgt
gagcgccagacagaggaagaggctaagcgtctgatggctgagaccaagctctggcgtctt
gccaactcggcaatgtgggtagcctggggcatcgtgcaagcccacgtccctggtttgccc
gacttcgacgcagaagagaagcgcgccagcggcaacgagaacgcggcggggcttgatgga
gcaacgaccgagatgcgcgcagaggcagaggcagaggcagaagaagagaagaaggcagga
agcgtgagtaaagagaaagtgggagagacagaaattgcaaacattggagctgaacaagat
gctgacatttacaaatcacaggatgaggaggagttcgactacctcgcgtatgcgcaggat
cgcgccatgttcttgtggggcgatgccatacgtatgggtatagtcaaggctgaggagttg
cccgcggaattgagggccagagttaggacggtggaatactag

DBGET integrated database retrieval system