KEGG   Phaeosphaeria nodorum: SNOG_02021Help
Entry
SNOG_02021        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 691 aa AA seqDB search
MSTPSTATATLPPHHQFYPHHQSYQPNLPSAQLQNGAARIGNSMYNGYASGTSTTDHRRT
ATAHARQSQQLPPISTGPAPDNSMSAPGSAGRRRNPDWADFYKNGLPKEVIVIDDDDEDP
APPPPRQPGLTRTATNGSARHTDKKRKTTASTAYDPVYNQQTSYSTTQTPYYDSPNHSLS
TDRTTSALNTTAATSLGSQVSNGHHISPLDNSAVGQKRKRTRAVAQDEAKQTKRRELDHD
DNPFSLYQPPPNPVIKAKDVYVQVVPDVRPSELSCARSDADSLQKSYTKDQKVDDEDGHY
IVVPEAELTERYQIEKLLGQGTFGKVVQAYDRKKGTKCAIKVIRSVPKYRDASRIELRVL
STLASNDKHNINRCIHLRDCFDFRNHICIVTDLYGQSVFDFLKSNGFVPFPSSHIQKFAK
QLFTSVAFLHDLNLIHTDLKPENILLVNNNYQTFTYNRTVPSSSTTVNRSARHRKVLLDP
EIRLIDFGSATFNDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALF
QTHDNLEHLAMMEAVCGGKIDRDIVRAVYKQDRGSSRNSANSAARYFKNYKLDYPNTETN
KASKKYVKAMKKLPETIPSHTDFNRQFLDLLRQIFVYDPKKRITAKQALQHPWFKESLMD
DGTEAHKIRIEREKKARRLEQDRRYRDERAY
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaccctccacggccacggctaccctcccgccccatcatcaattctatcctcac
caccagtcctaccagccaaacctgccgagtgcgcagctccagaacggcgccgcgaggata
ggcaattccatgtacaacggctacgctagcggcacctcgacaacagaccaccgcaggacc
gcgaccgcccacgcccgccagtcccagcagctgccacccatatccacaggccccgcgccc
gacaactccatgagcgcgcctggctcggctggtcggcggcggaaccccgactgggctgac
ttctacaaaaacggcctccccaaagaggtcatcgtgattgatgacgacgacgaagacccg
gctcctcccccgccgcgccagccaggcctcaccaggaccgcgacaaatggctcggcacgg
cacacggacaagaagcgaaagacgacggcgtccacggcatacgaccctgtctacaatcag
cagacatcctactcgactacccaaacgccgtactacgactcgcccaaccactccctctcc
accgacaggaccacttctgcgctcaacacgacagctgcgacgtcattaggttcgcaggtc
agcaatggacaccacatctcgccgctcgacaacagcgccgttggccagaagcgaaagcgc
acgcgtgcagtagcccaggacgaggccaagcagaccaagagacgagagctcgaccacgac
gacaaccccttcagcctgtaccagcctccgcctaacccagtaatcaaggcgaaggatgtt
tatgtgcaggttgttccggatgtaaggccctcagaactatcctgtgcgcgatcagacgct
gactcattgcagaagtcctacaccaaggaccagaaggtcgatgatgaggatggccactat
attgtggttccagaggccgaactcaccgagcgataccagatcgagaaactcctaggccaa
ggcacatttggtaaggtcgttcaagcctatgatcgaaagaagggcaccaaatgcgccatc
aaggtcatcagatccgtgcccaagtaccgagacgccagtcgcatcgagttgagagtcctc
tcaacactggcatccaacgacaagcacaacatcaacaggtgcatccatctgagggattgc
ttcgactttcggaaccacatttgcatcgtcaccgacctctacggacagagtgtgttcgac
ttcctcaagtcgaatggcttcgtgccgttccccagctcgcacattcaaaagtttgcgaag
cagctgttcacgagcgttgcctttctgcacgatctgaatctcatccacaccgatctgaag
ccggagaacatcctcctcgtaaacaacaactaccagaccttcacatacaaccggacagtc
ccttcctcatcaaccactgtcaaccgcagcgcgagacaccgcaaggtgcttctcgaccca
gagatccggttgattgactttggatcagccaccttcaatgacgagtaccactcctccgtc
gtgtcgacacgtcactaccgtgcaccagagatcatcctcaacctgggctggagcttcccg
tgcgacatttggagtattggttgtattctagtcgaattcttcaccggtgacgccctgttc
cagacgcacgataacctcgaacatctggctatgatggaggccgtgtgcggaggcaagatc
gaccgagacattgtgcgcgcagtctacaagcaagaccgagggtcatcacggaactctgcc
aattctgctgcaagatatttcaaaaactacaagcttgactatccaaataccgagaccaac
aaggcgtcgaagaaatacgtcaaggcgatgaagaagcttcctgaaaccatccccagtcat
accgactttaaccgccaattcctcgatcttctcaggcagatcttcgtttacgatcccaag
aagcgtataactgccaagcaagccttgcaacatccgtggttcaaggagtctctcatggac
gatggtaccgaggctcacaagatccggatagagcgagagaagaaggcacggcgattagaa
caagatcgccggtatcgagacgaaagggcctactag

DBGET integrated database retrieval system