KEGG   Phaeosphaeria nodorum: SNOG_02082Help
Entry
SNOG_02082        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
pno  Phaeosphaeria nodorum
Brite
Exosome [BR:pno04147]
 Exosomal proteins
  Proteins found in most exosomes
   SNOG_02082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MSWQAYVDQSLVGTGNIDKALICDVNGQTTWASSPDFSLTAAEMSAIAASFNDKSETKAV
IANGVKVNGDKYMTIESTDDSLKAKKGKEGIVAYKTTQALLIAHHPDSIQTPNAFNSVVE
LGEYLKKVGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcatacgttgatcagagcctcgtcggcactggcaacatcgacaaggcc
ctcatctgcgatgtcaacggccaaaccacctgggcctcgtctccagacttctccctcact
gccgctgagatgagcgccatcgccgcctccttcaacgacaagagcgagaccaaggccgtc
atcgcaaacggcgtcaaggtcaatggcgacaagtacatgaccatcgagtcgaccgacgac
tcgctgaaggcaaagaagggcaaggaaggcatcgtcgcctacaagaccacacaagccctc
ctcatcgcccaccaccccgactccatccaaacgcccaacgccttcaactcagtcgttgag
ctcggcgagtacctcaagaaggtcggctactaa

DBGET integrated database retrieval system