KEGG   Phaeosphaeria nodorum: SNOG_02461Help
Entry
SNOG_02461        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SNOG_02461
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SNOG_02461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 312 aa AA seqDB search
MSGGWNTIESDAGVFTYLIEKLGVKDVQFEELTTLEASELEQLGTVYGVIFLFKYPTGEA
RGETPKDGTYDHEAANNIFFAAQTIQNACGTQAIVSLLLNREKEVNIGKELKEFKEFAGE
FPPELRGETLSNSDLIRETHNSFARSSPFIDETQRTATEDDDVYHFIAYTSINNTLYELD
GLQPAPISHGACKPTEFPTKIIPVLQRRIARYPATEIRFNLMACVRDLRIRAREIGDEEE
LEQQEDRRAQWLWENSLRRHNFVGFISELLKGVVAAKLKEGNGAYDKWVEEAKGRSRKRR
EDARKQGIASED
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaggctggaataccatagagtccgatgccggcgtattcacatatctaatcgag
aagctcggcgttaaggatgtacaattcgaagagctcacaacgctcgaggcctcagagctt
gaacagctaggcacggtctatggcgtgatcttcctcttcaagtaccccaccggcgaagca
cgcggcgagacaccgaaagatggcacttatgaccatgaggcggcaaataacatcttcttc
gcggcgcaaaccatacagaacgcttgcggtacccaggcaattgtgtcgcttctgctgaac
agggagaaggaagtcaacattggcaaagaactgaaagagttcaaggagttcgccggagag
ttcccgccagagctacgaggagagacgctctcaaactcggatctcattcgggaaacacac
aactccttcgcgcgatcatctcccttcatcgacgagacacaacgaaccgcgaccgaagat
gacgacgtgtaccactttatcgcttatacgtcaataaacaacaccctctacgaactcgac
ggcctccagcccgcccccatctcccacggcgcatgcaaacccaccgagttccccactaag
attatccccgtcctccaacgccgcatcgcccgctaccccgccaccgaaatccgcttcaac
ctcatggcttgtgtacgcgacctgcgcatccgtgcccgcgagattggcgacgaggaagag
cttgagcagcaagaagacaggcgcgcgcaatggttgtgggagaactcgctgcgaagacac
aacttcgttggctttatcagcgagctgttgaagggcgttgtggctgcgaagctgaaggag
ggtaatggtgcgtatgacaagtgggttgaggaggcgaaggggaggagtcggaagaggagg
gaggacgcgaggaagcaagggatagctagtgaagactga

DBGET integrated database retrieval system