KEGG   Phaeosphaeria nodorum: SNOG_02547Help
Entry
SNOG_02547        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pno  Phaeosphaeria nodorum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pno00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pno00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 781 aa AA seqDB search
MGIAATGSTDLAFEVAKATAKEIAACGINWIFGPCLDVLTNARNQPLGVRTAGDDPQEVS
AFGCAFMQGYKEAGVVTLGKHFPSYGNLEFLGSTLDVPIITESLEQLSLSALVPFKKAIE
RGLDSMMVGGCAMSSAGLNAMHACLSEQVVDELLRKDLQFNGVVVSECLEMDALSHNIGV
GGGTVMAVNAGCDVVLLCRAVSLQQEGLKGLKTGVETEMVSKQRIYDSLSRVLAMKAKCT
SWEKALNPPGLDYLETLQPLHTALSTKAYNSSISVVRDKNRLLPLTNILESEEELLLLTP
LVKPLAASAASRALSDVATANAHSPEPAAWERSASVMSVTADANRNLYQHGFTKHVSMIC
NMQYTTGGERREKPLIVVAVSSPYDFAMDTSIGTYICTYDFTETALNSLVRVLYGELSPT
GTLPGTISKSQKLHPSRQHWLVEIFNEERDANALDTLVTAVIDSAQPNQRSELSSATSNS
FILHHPEIEQSHFVVRNSSTQALYGFCSTYFFKSTGTGVIGALFVDPGRRKLSIGHSLHN
RAIRTLLQKEGIKRFQLGSRLPSMYLGIPTGHGSERKRLRSWFANLGWGAALSRPVCNMV
ARNLQTWSPPDGMAKSLESAGSQFDLVYGWDYAGPILDHIKTSNRQGLAEVYKLALSDPS
ACGIIRAKRPEDGALVGTVVLYNHHSRLSEYIPPLKDLNEAAGGISSPVISPGVGEYSTL
LQGLILLGMRQIKAQGCNACLLDYMDGDGNFDGFSSMGFDVMHNFEEVSCDAATWTMIPP
A
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgggtatagctgcgacaggttcgacagacctggcattcgaagtcgccaaagcaacagca
aaagagattgctgcctgtggaatcaactggatattcggaccctgtctcgatgtgctcacc
aatgctaggaatcagccgctcggtgtgagaacagcgggcgatgatccacaggaagtctct
gcctttggatgcgcgtttatgcaaggctataaagaggctggagttgtcacgttgggcaag
cacttcccgtcatatggcaatctggagtttcttggctcaacactcgatgtgcccatcatt
acagaatcgttagagcaactcagccttagtgctttggtcccttttaagaaggctatagaa
agaggcttggactcaatgatggtcggtggatgcgccatgtcctcggcgggtctcaacgca
atgcacgcatgcttgtcagagcaagtcgtggacgagctactacggaaagatctacaattc
aacggagttgtcgtatcagaatgtctcgagatggatgctcttagccacaatattggagtg
ggtgggggcacagtcatggctgtcaacgctggctgtgatgttgtgcttctatgtcgcgcg
gtttcgctgcaacaagaagggctcaagggactcaagactggggttgagactgagatggtg
tcgaagcaaagaatatacgactcgctcagccgggttttggcgatgaaggcaaagtgcaca
tcgtgggaaaaagcgctcaaccctcctggcctcgactacctggaaaccttacaaccattg
catacagcactttcaacgaaagcatacaacagctcgatatcggtggtacgtgataagaac
agactgctccccttgaccaacatactcgagagcgaggaagagctgctcctgcttacgccc
ttggtgaaacccttggctgcatctgctgcatctcgagctttatctgacgttgctactgca
aatgctcattctcccgaacctgccgcatgggagcggagtgcgtcggtcatgagtgtcact
gcggatgctaatcgcaacctataccagcatggctttacgaaacatgtctcgatgatctgt
aacatgcaatacactaccggtggcgagcgccgtgagaaaccgctgatagtagtagccgtc
agttcgccatatgactttgctatggatactagcattggcacatacatttgtacctacgac
ttcacagaaacagccctcaactcgctggtccgtgtgctttacggggaactgtcgcccacc
ggtacgcttccaggcactatcagcaagagtcagaagcttcatccttcgaggcaacattgg
ttggtggagattttcaacgaagagcgggatgctaacgccctggacactctggtaacagct
gtgattgacagtgcgcagccgaatcagcgatcggagctgtccagcgccacgtcaaactct
ttcattctacatcacccagagattgaacagtctcatttcgtggtccgcaacagcagcact
caggcgctatatggcttttgttcgacctatttcttcaagtcgacgggtaccggcgttatc
ggggcattgtttgtagacccaggaaggaggaagctttcaatcggccactctcttcacaac
agagctattaggacgttgttacagaaagagggtatcaagcgattccaactgggttcacgg
ttacctagcatgtatcttggcattccaaccggccatgggtcggaacgaaagcggctaagg
tcatggtttgccaatctgggctggggtgctgcgctatctcgtccagtttgtaatatggtg
gcgcggaatctgcagacgtggagcccaccagatggcatggccaagagcctggaaagtgct
ggttcccagtttgatctcgtttacgggtgggactatgcgggcccaatcctcgaccacatc
aagacaagtaaccggcaaggacttgctgaagtatacaagctggcactttcagacccatca
gcatgcggcatcatccgagcgaagcggcctgaagacggagctttggttggcacagtagtg
ctctacaaccaccattcccgcctatctgagtacatccctcccctcaaagacctcaacgag
gctgctggaggaatttcctctcccgtgatatcgccaggggtgggtgaatactcgacgctg
ctccagggcttgatccttctcgggatgagacagatcaaagcgcaggggtgcaatgcctgt
ctgctcgactatatggatggagacggcaactttgatgggttttcgtcgatgggatttgac
gtcatgcacaacttcgaggaggtgagctgcgatgcggcgacttggaccatgattccgccg
gcgtaa

DBGET integrated database retrieval system