KEGG   Phaeosphaeria nodorum: SNOG_02547Help
Entry
SNOG_02547        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pno  Phaeosphaeria nodorum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SNOG_02547
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SNOG_02547
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SNOG_02547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 781 aa AA seqDB search
MGIAATGSTDLAFEVAKATAKEIAACGINWIFGPCLDVLTNARNQPLGVRTAGDDPQEVS
AFGCAFMQGYKEAGVVTLGKHFPSYGNLEFLGSTLDVPIITESLEQLSLSALVPFKKAIE
RGLDSMMVGGCAMSSAGLNAMHACLSEQVVDELLRKDLQFNGVVVSECLEMDALSHNIGV
GGGTVMAVNAGCDVVLLCRAVSLQQEGLKGLKTGVETEMVSKQRIYDSLSRVLAMKAKCT
SWEKALNPPGLDYLETLQPLHTALSTKAYNSSISVVRDKNRLLPLTNILESEEELLLLTP
LVKPLAASAASRALSDVATANAHSPEPAAWERSASVMSVTADANRNLYQHGFTKHVSMIC
NMQYTTGGERREKPLIVVAVSSPYDFAMDTSIGTYICTYDFTETALNSLVRVLYGELSPT
GTLPGTISKSQKLHPSRQHWLVEIFNEERDANALDTLVTAVIDSAQPNQRSELSSATSNS
FILHHPEIEQSHFVVRNSSTQALYGFCSTYFFKSTGTGVIGALFVDPGRRKLSIGHSLHN
RAIRTLLQKEGIKRFQLGSRLPSMYLGIPTGHGSERKRLRSWFANLGWGAALSRPVCNMV
ARNLQTWSPPDGMAKSLESAGSQFDLVYGWDYAGPILDHIKTSNRQGLAEVYKLALSDPS
ACGIIRAKRPEDGALVGTVVLYNHHSRLSEYIPPLKDLNEAAGGISSPVISPGVGEYSTL
LQGLILLGMRQIKAQGCNACLLDYMDGDGNFDGFSSMGFDVMHNFEEVSCDAATWTMIPP
A
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgggtatagctgcgacaggttcgacagacctggcattcgaagtcgccaaagcaacagca
aaagagattgctgcctgtggaatcaactggatattcggaccctgtctcgatgtgctcacc
aatgctaggaatcagccgctcggtgtgagaacagcgggcgatgatccacaggaagtctct
gcctttggatgcgcgtttatgcaaggctataaagaggctggagttgtcacgttgggcaag
cacttcccgtcatatggcaatctggagtttcttggctcaacactcgatgtgcccatcatt
acagaatcgttagagcaactcagccttagtgctttggtcccttttaagaaggctatagaa
agaggcttggactcaatgatggtcggtggatgcgccatgtcctcggcgggtctcaacgca
atgcacgcatgcttgtcagagcaagtcgtggacgagctactacggaaagatctacaattc
aacggagttgtcgtatcagaatgtctcgagatggatgctcttagccacaatattggagtg
ggtgggggcacagtcatggctgtcaacgctggctgtgatgttgtgcttctatgtcgcgcg
gtttcgctgcaacaagaagggctcaagggactcaagactggggttgagactgagatggtg
tcgaagcaaagaatatacgactcgctcagccgggttttggcgatgaaggcaaagtgcaca
tcgtgggaaaaagcgctcaaccctcctggcctcgactacctggaaaccttacaaccattg
catacagcactttcaacgaaagcatacaacagctcgatatcggtggtacgtgataagaac
agactgctccccttgaccaacatactcgagagcgaggaagagctgctcctgcttacgccc
ttggtgaaacccttggctgcatctgctgcatctcgagctttatctgacgttgctactgca
aatgctcattctcccgaacctgccgcatgggagcggagtgcgtcggtcatgagtgtcact
gcggatgctaatcgcaacctataccagcatggctttacgaaacatgtctcgatgatctgt
aacatgcaatacactaccggtggcgagcgccgtgagaaaccgctgatagtagtagccgtc
agttcgccatatgactttgctatggatactagcattggcacatacatttgtacctacgac
ttcacagaaacagccctcaactcgctggtccgtgtgctttacggggaactgtcgcccacc
ggtacgcttccaggcactatcagcaagagtcagaagcttcatccttcgaggcaacattgg
ttggtggagattttcaacgaagagcgggatgctaacgccctggacactctggtaacagct
gtgattgacagtgcgcagccgaatcagcgatcggagctgtccagcgccacgtcaaactct
ttcattctacatcacccagagattgaacagtctcatttcgtggtccgcaacagcagcact
caggcgctatatggcttttgttcgacctatttcttcaagtcgacgggtaccggcgttatc
ggggcattgtttgtagacccaggaaggaggaagctttcaatcggccactctcttcacaac
agagctattaggacgttgttacagaaagagggtatcaagcgattccaactgggttcacgg
ttacctagcatgtatcttggcattccaaccggccatgggtcggaacgaaagcggctaagg
tcatggtttgccaatctgggctggggtgctgcgctatctcgtccagtttgtaatatggtg
gcgcggaatctgcagacgtggagcccaccagatggcatggccaagagcctggaaagtgct
ggttcccagtttgatctcgtttacgggtgggactatgcgggcccaatcctcgaccacatc
aagacaagtaaccggcaaggacttgctgaagtatacaagctggcactttcagacccatca
gcatgcggcatcatccgagcgaagcggcctgaagacggagctttggttggcacagtagtg
ctctacaaccaccattcccgcctatctgagtacatccctcccctcaaagacctcaacgag
gctgctggaggaatttcctctcccgtgatatcgccaggggtgggtgaatactcgacgctg
ctccagggcttgatccttctcgggatgagacagatcaaagcgcaggggtgcaatgcctgt
ctgctcgactatatggatggagacggcaactttgatgggttttcgtcgatgggatttgac
gtcatgcacaacttcgaggaggtgagctgcgatgcggcgacttggaccatgattccgccg
gcgtaa

DBGET integrated database retrieval system