KEGG   Phaeosphaeria nodorum: SNOG_02669Help
Entry
SNOG_02669        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01027  
3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
pno  Phaeosphaeria nodorum
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SNOG_02669
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SNOG_02669
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SNOG_02669
Enzymes [BR:pno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SNOG_02669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 507 aa AA seqDB search
MSKPSAATMFQFTLLSQRSFFRDSWVFSSSLRRNEINKVFPSAEAAIADMQSDSTLLCGG
FGLSGVPDTLINSVKSNPSITGLTAVSNNAGIVGGGLGLLLESKQVKKMIASYVGENKVL
EQMYLTGELELELTPQGTLAERCRAGGAGIPAFYTPAAFGTVVQTGELALRHNSDGSVAQ
YSTPRDVKVFAGKSYVMEESIKGDYAFIKAYKADRLGNVQFRFSAQNFNGAMARNAKVTI
VEAEHIVDVGSIEPNAVHVPGIYVDRVIQSTTPKNIEKIVNAKDPNEAVSDLGKGDAASK
RERIVRRAAKEFKNGMYANLGIGMPMLAPSFVPASVEVQLQSENGILGLGPYPAAGLEDP
DLINAGKETVTLLPGASCFGSEESFGMIRAGKIDLTILGAMQVSARGDLANWMLPGKVKG
FGGAMDLVSNPEKTKVVVTMEHTDKKGRPKILKQCEFPLTGKACCVFDVDFTEGLTLIEL
ADGVTVDEVRSKTGAEFKEAAEIKPML
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgagtgccgcgacaatgtttcaattcacgctgttgtcgcaacgctcgttc
ttccgcgattcttgggtcttctcctcgtcactccgccgcaatgagatcaacaaagtgttc
cccagcgctgaagccgcaatcgcggacatgcaatctgacagcaccctcttgtgcggtggc
ttcggtctctcaggtgtaccagacaccttgatcaattcagtcaaatccaacccatccatc
accggcctgaccgccgtatccaacaacgccggtatcgttggcggtggtctcggtctcctg
ctcgagagcaaacaagtcaagaagatgatcgcatcctacgtcggcgagaacaaagtcctc
gagcaaatgtacctcactggcgaactcgagctcgaactcaccccgcaaggcaccctcgcc
gaacgatgtcgcgccggcggcgcaggcatacccgccttctacacccccgccgcgttcggc
accgtcgtgcaaaccggcgagctcgcccttaggcacaacagcgacggatctgtcgcgcaa
tactcgacaccgcgagacgtgaaggtcttcgctggcaagagctacgtcatggaagaaagc
atcaagggcgactacgccttcatcaaagcctacaaagccgaccggctaggaaacgtacaa
ttccgcttcagcgcgcagaacttcaacggcgccatggcgcgcaatgcgaaagtcacaatc
gtcgaggccgaacacattgtcgacgtcgggagtatcgagcccaacgcagtccacgtcccg
ggcatctacgtcgaccgcgtaatccaatccaccaccccaaagaacattgagaaaatcgta
aacgcaaaagaccccaacgaagccgttagcgatctaggcaagggcgacgcggcatccaag
cgcgaacgcatcgtgcggcgcgcagccaaggagttcaaaaacggcatgtatgccaacctt
ggaatcggaatgcctatgctcgcaccttcctttgtcccagcatccgtagaagtccaattg
caatcggaaaacggcatcctcggtctcggcccgtatcccgctgccggcctcgaagacccg
gacctcatcaacgcaggcaaagagaccgtcactctactccccggcgcgtcgtgcttcggg
agcgaagagtcgttcggcatgatccgcgcgggcaagatcgacctgacaatcctcggcgcg
atgcaagtgtccgcgcggggcgatttagcgaactggatgttgccgggcaaagtcaagggg
ttcgggggcgcgatggatttggtgagtaaccccgagaagacaaaggtggtggttacaatg
gagcatacggataaaaaggggcggccgaagattcttaaacagtgcgagtttccgttgacg
ggcaaggcgtgttgcgtgtttgatgtcgatttcactgaggggctgacgctgattgaactt
gcggatggcgttacggtggatgaggtacggtcgaagacgggcgctgagttcaaggaggcg
gcggagattaagcccatgttgtga

DBGET integrated database retrieval system