KEGG   Phaeosphaeria nodorum: SNOG_02669Help
Entry
SNOG_02669        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01027  
3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
pno  Phaeosphaeria nodorum
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pno00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pno00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pno00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 507 aa AA seqDB search
MSKPSAATMFQFTLLSQRSFFRDSWVFSSSLRRNEINKVFPSAEAAIADMQSDSTLLCGG
FGLSGVPDTLINSVKSNPSITGLTAVSNNAGIVGGGLGLLLESKQVKKMIASYVGENKVL
EQMYLTGELELELTPQGTLAERCRAGGAGIPAFYTPAAFGTVVQTGELALRHNSDGSVAQ
YSTPRDVKVFAGKSYVMEESIKGDYAFIKAYKADRLGNVQFRFSAQNFNGAMARNAKVTI
VEAEHIVDVGSIEPNAVHVPGIYVDRVIQSTTPKNIEKIVNAKDPNEAVSDLGKGDAASK
RERIVRRAAKEFKNGMYANLGIGMPMLAPSFVPASVEVQLQSENGILGLGPYPAAGLEDP
DLINAGKETVTLLPGASCFGSEESFGMIRAGKIDLTILGAMQVSARGDLANWMLPGKVKG
FGGAMDLVSNPEKTKVVVTMEHTDKKGRPKILKQCEFPLTGKACCVFDVDFTEGLTLIEL
ADGVTVDEVRSKTGAEFKEAAEIKPML
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgagtgccgcgacaatgtttcaattcacgctgttgtcgcaacgctcgttc
ttccgcgattcttgggtcttctcctcgtcactccgccgcaatgagatcaacaaagtgttc
cccagcgctgaagccgcaatcgcggacatgcaatctgacagcaccctcttgtgcggtggc
ttcggtctctcaggtgtaccagacaccttgatcaattcagtcaaatccaacccatccatc
accggcctgaccgccgtatccaacaacgccggtatcgttggcggtggtctcggtctcctg
ctcgagagcaaacaagtcaagaagatgatcgcatcctacgtcggcgagaacaaagtcctc
gagcaaatgtacctcactggcgaactcgagctcgaactcaccccgcaaggcaccctcgcc
gaacgatgtcgcgccggcggcgcaggcatacccgccttctacacccccgccgcgttcggc
accgtcgtgcaaaccggcgagctcgcccttaggcacaacagcgacggatctgtcgcgcaa
tactcgacaccgcgagacgtgaaggtcttcgctggcaagagctacgtcatggaagaaagc
atcaagggcgactacgccttcatcaaagcctacaaagccgaccggctaggaaacgtacaa
ttccgcttcagcgcgcagaacttcaacggcgccatggcgcgcaatgcgaaagtcacaatc
gtcgaggccgaacacattgtcgacgtcgggagtatcgagcccaacgcagtccacgtcccg
ggcatctacgtcgaccgcgtaatccaatccaccaccccaaagaacattgagaaaatcgta
aacgcaaaagaccccaacgaagccgttagcgatctaggcaagggcgacgcggcatccaag
cgcgaacgcatcgtgcggcgcgcagccaaggagttcaaaaacggcatgtatgccaacctt
ggaatcggaatgcctatgctcgcaccttcctttgtcccagcatccgtagaagtccaattg
caatcggaaaacggcatcctcggtctcggcccgtatcccgctgccggcctcgaagacccg
gacctcatcaacgcaggcaaagagaccgtcactctactccccggcgcgtcgtgcttcggg
agcgaagagtcgttcggcatgatccgcgcgggcaagatcgacctgacaatcctcggcgcg
atgcaagtgtccgcgcggggcgatttagcgaactggatgttgccgggcaaagtcaagggg
ttcgggggcgcgatggatttggtgagtaaccccgagaagacaaaggtggtggttacaatg
gagcatacggataaaaaggggcggccgaagattcttaaacagtgcgagtttccgttgacg
ggcaaggcgtgttgcgtgtttgatgtcgatttcactgaggggctgacgctgattgaactt
gcggatggcgttacggtggatgaggtacggtcgaagacgggcgctgagttcaaggaggcg
gcggagattaagcccatgttgtga

DBGET integrated database retrieval system