KEGG   Phaeosphaeria nodorum: SNOG_02819Help
Entry
SNOG_02819        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
pno  Phaeosphaeria nodorum
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SNOG_02819
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SNOG_02819
   00640 Propanoate metabolism
    SNOG_02819
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SNOG_02819
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SNOG_02819
Enzymes [BR:pno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SNOG_02819
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SNOG_02819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2246 aa AA seqDB search
MAGAAQKEVNGSANGGPSSYAAKFNLAPHFIGGNHLHAAAPGKVKDFVAAHDGHTVITNV
LIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLQANAEYIRMADQYVEVPGG
TNNNNYANVELIVDVAERMNVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAMRS
LGDKISSTIVAQHAKVPCIPWSGTGVEEVVVDDHGIVTVEDHIYEQGCTKSWEEGLAAAK
KIGFPVMVKASEGGGGKGIRKVEREEDFQQLYAAAASEIPGSPIFIMKLAGSARHLEVQL
VADQYGNNISLFGRDCSVQRRHQKIIEEAPVTVAPNKTFQEMEKAAVSLGRLVGYVSAGT
VEYLYSHAEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGLPLHRIRDIRLLYG
ADPHTSSTIDFDFSKEGSVQNQRRPTPKGHCTACRITSEDPDEGFKPSGGTIHDLNFRSS
SNVWGYFSVSSAGGIHSFSDSQFGHIFAYGENRQASRKHMVVALKELSIRGDFRTTVEYL
IKLLETPAFEDNTITTGWLDELITKKLTAERPDPMIAVICGAVTKAHAASEACINEYKTS
LEKGQVPSKDVLKTVFPIDFIYEGFRYKFTATRSTIDSFTLFINGSKCAVGVRALSDGGL
LILLAGKSHNVYWKEEVGATRLFVDGKTCLLEQENDPTQLRTPSPGKLVRFLVENGDHIG
KNQPFAEVEVMKMYMPLIAQEDGIVNLIKQPGATLEAGDILGVLALDDPSRVKTAQTFLG
LLPDMGAPQIMGSKPPQRFVALNNILQNILQGFDNQVIMQSTLKELVEVLRDPELPYGEW
NAQASALHARMPQKLDTTFSQIVEKAHGRNLEFPGKALSKAFQKFLDETVAKGDRDLLKA
ALAPLTDVIARYSEGLKAHEYATMTKYLEMYYAVEQLFSSRNSRDEEVVLKLRDENRDNI
SNVVHTVLSHARVSAKNNLVIAILDLYRPNKPGVGNIAKYFKNTLKKLTDLESRQTAKVS
LKAREVLIQCAMPSLEERTSQMEHILRSAVVESRYGESGWDHREPNFEVIKEVVDSRFTV
FDVLTQFFVHPDPWVALAALEVYTRRAYRAYHLQEINYHNEGEQQCLLSWDFILRKVGEA
EYGLTVEPSEPGTPMTPGFDRGPPRIHSLSDMSAISNRFENEPSRKGVVVPVEYLDDADE
LIAKALELFPTVGAKKGGLTLRENLSMKRTPTSGALDTKAGSDELTGVLNIAVRDIESFD
DKEIMDRILPIVEEYKSELAAHRIRRITFICGHKDGTYPGYYTFRGPTYEEDDSIRHVEP
ALAFQLELGRLSKFNIKPVFTENRNIHIYEAVGKGAESDKRYFLRAVVRSGRLREEIPTA
EYMISETDRLMTDILDALEIVGTSQADMNHIFINFSHVFPLNPTEVEEAIGGFLERFGRR
LWRLRVTGAEIRIIVTDPQTGIPYPLRVIITNTSGYVIQVEMYAERKSEKAGKWLFHSIG
GTTKIGSLHLQPVSTPYPTKGALQPKRYKAHLMGTQYVYDFPELFRQATENAWQAAISKH
SYLRDKLPPKGECLEYYELVLDENDNLAEVNRDPGFNTIGMVGWIVTAKTPEYTRGRRFI
IIANDITFKIGSFGPQEDAFFHKCSELARKLGIPRIYLSANSGARIGLAEELIPHFSVAW
KDIDRPEAGFDYLYLTPEKYGHFVDGKRNDVICEKIQVDDETRFKITTVIGQEDGLGVES
LRGSGLIAGETSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQIEGQPIILTGAQAINK
LLGREVYTSNLQLGGTQIMYRNGVSHMTADDDFEGVSKIVKWLSYVPDKKGSPVPISPTA
DDWDRDVAYYPPGKGTAYDVRHLIAGKTDEDGFLPGLFDKDSFEESLGGWAKTVVVGRAR
LGGIPIGVIGVETRSVENVTPADPANPDSIEQVTSEAGGVWYPNSAYKTAQAINDFNHGE
QLPLMILANWRGFSGGQRDMYNEVLKYGSYIVDALVNTWEMYADEDSRGGVLEPEGIVGI
KYRKEKQLETMARNDPTYGALKRKLNDPATPKDQLQAIKTQMNEREKTLLPIYGQIAIQF
ADLHDRAGRMQAKGVIRQALRWQNARRFFYWRLRRRLNEEYIIKKLVAVAPTEDITSTRA
RGLEMLKAWCNIPNFATDDMSVATWYEENRQNVHERVLKLKAESTSLKVAQMISEDRESG
LRGVMNLLSTLPTAEKEQVLNMLSRA
NT seq 6741 nt NT seq  +upstreamnt  +downstreamnt
atggctggagctgcacagaaggaagttaatggctctgccaatggcgggccgagctcctac
gcggccaagttcaatcttgcgccgcattttatcggcggaaaccacctgcacgctgctgcg
ccgggcaaggtcaaggactttgtcgcagcgcacgacggacacacggtcattacaaatgtg
ctcattgcgaacaacggtattgcagcagtcaaggagatccgctcggtgcggaagtgggca
tacgagacttttggcgatgagcgggcaatccagttcaccgtcatggccacgcccgaggat
ctgcaggccaatgcagagtacatccgcatggcggaccagtatgtcgaggtccccggaggc
accaacaacaacaactacgccaacgtcgagctcattgtcgatgtcgcggagcgaatgaac
gtccacgctgtatgggcgggctggggacacgcctcagagaaccccaagctgcccgaatcg
cttgcggcctctcccaagaagattgtcttcatcggccctcccggttcggccatgcgctcg
ctcggagacaagatttcgtccacaattgttgcacaacacgccaaagtgccgtgtattccg
tggtcgggaacaggcgtcgaggaggtcgtggtcgacgaccacggcatcgtcacggtcgag
gatcacatatacgagcagggctgcaccaagtcatgggaagagggtcttgcggcggccaag
aagatcggtttccctgtcatggtcaaggcctcggaaggaggtggtggcaagggcatccga
aaagtcgagcgtgaggaggacttccagcagctgtacgcagccgctgcctctgagattccc
ggctcgcccatcttcatcatgaagctcgcgggtagcgcacggcatttggaggtccagctg
gtggccgatcagtatggcaacaacatctcgcttttcggacgtgactgctccgtgcagcga
cgacaccagaagatcattgaggaggcgccagtaacagtcgcccccaacaagaccttccag
gagatggagaaggcagctgtctcccttggaagactcgtcggatacgtctcagccggtacc
gttgagtacctgtactcgcacgctgaggataagttctacttcctcgagttgaaccctcgt
cttcaagtcgagcatcccaccaccgagatggtgacaggcgtcaacctcccagccgcccag
ctccagatcgccatgggtctcccactccaccgcattcgcgacattcgcctgctctacggc
gcagacccccacaccagctcgaccatcgatttcgacttttcgaaggagggcagcgtacag
aaccagcgacgaccaactcccaagggtcattgcacagcctgccgtatcacgtctgaagac
cctgacgagggcttcaagccatctggcggtactattcacgacctcaacttcaggagtagc
tccaatgtctggggttacttctccgtgagttccgccggtggtattcacagcttctccgat
tcgcagtttggtcacatctttgcctatggtgagaatcgacaagcttcgcggaaacacatg
gttgttgcgctgaaggaattgagcattcgtggagacttccgaactacggtcgaatacctc
atcaagttgcttgaaactccagctttcgaggacaacacaatcaccactggttggctcgac
gagctcatcactaagaagttgactgccgaacgacccgacccaatgatcgcagtcatttgc
ggtgctgtcaccaaggcccacgctgctagcgaagcttgcatcaacgagtacaagactagt
ttggagaagggtcaggtcccatctaaggacgttctcaagactgtgttccccattgacttc
atttacgaaggctttcgttacaagttcacagctaccaggtccaccatcgacagcttcaca
cttttcatcaacggctcgaagtgcgctgttggtgtcagggctctttctgacggtggactt
ctaatcttgcttgctggaaagtcccacaacgtttactggaaggaggaagttggtgctact
cgtctctttgtcgatggcaagacttgccttcttgagcaggagaacgacccaactcagctc
cgtacaccatctcctggtaagctcgttcgcttcctggttgagaacggtgaccacatcggc
aagaaccagccttttgctgaggttgaggtaatgaagatgtacatgcctttgattgcgcaa
gaggatggtatcgtcaacctcatcaagcagccaggtgctactcttgaggctggtgacatc
cttggtgttctagccctggacgacccatccagagtcaagactgcgcaaaccttccttggt
cttcttccagacatgggagctccccagatcatgggcagcaagcccccgcagaggttcgtg
gctctcaacaacatcctccagaacatcctccagggtttcgacaaccaggtcatcatgcag
agcacgctcaaggaacttgtcgaggttctgcgcgaccccgagctcccttacggtgagtgg
aatgcgcaagcttctgctctccatgctcgtatgcctcagaagcttgacaccacgttctct
caaatcgtggagaaggcccacggccgcaacctggagttccccggaaaggcactcagcaag
gctttccagaagttcttggatgagacagtcgcaaagggtgatcgagatctcctgaaggcc
gcacttgccccgctgaccgatgtcattgctcgctactctgagggtctcaaggcccatgag
tacgcaactatgactaagtacctagagatgtactacgctgtcgagcagctcttctcctcg
cgcaactcacgagacgaagaggtcgttctcaagctgcgtgacgagaaccgtgataacatt
tccaatgttgtgcacaccgtactctcccacgcccgcgtcagcgcaaagaacaacctcgtg
attgccattctcgacttgtaccgacccaacaagccaggcgttggcaacattgccaagtac
ttcaagaacacactcaagaagctcaccgatctcgaatcgaggcaaactgccaaggtctcc
ttgaaggctcgtgaggtgctcattcagtgcgccatgccttcgctcgaagagcgtacctct
cagatggagcacatcctccgatcggcagttgtcgaatcacgctacggcgagagcggctgg
gaccatcgtgagcctaactttgaggtcatcaaggaggttgtagactcgcgctttactgtc
tttgatgtcttgacccaattcttcgtccacccggacccttgggttgcccttgctgctttg
gaggtgtacactcgccgcgcttaccgtgcgtaccacctccaggagatcaactaccacaac
gaaggcgaacagcaatgtctcttatcgtgggacttcattctccgtaaggtgggagaggcc
gagtacggtctcactgttgagccatctgagccgggtacacccatgacgccaggttttgat
cgtggcccaccccgcatccactcgctcagcgatatgtctgcaatcagcaaccgcttcgaa
aatgagccctcccgcaagggtgtggttgtccctgtcgagtatcttgacgatgcggatgag
cttattgccaaggctcttgagttattccctactgttggtgctaagaagggtggcttgacc
ttgagggagaatctcagcatgaagcgtacgcctacctcgggtgcgctggacaccaaggct
ggcagcgatgaactgactggtgtcctgaacattgcggtccgcgacatcgagagcttcgat
gacaaagaaatcatggatcgcattcttcccatcgtggaggaatacaagagcgagcttgct
gcgcaccgcatccgccgcatcaccttcatctgcggtcacaaggatggaacctatcctggc
tactacaccttccgtggacctacatacgaagaggacgacagcattcgtcacgttgaaccc
gctcttgccttccagcttgagcttggtagactctcaaagttcaacatcaagcctgtcttc
accgagaaccgcaacatccacatttacgaggctgttggcaagggtgctgagagcgacaag
cgctatttcttgcgcgctgttgttcgatcaggtcgtcttcgggaagagattcctactgcc
gagtacatgatctctgaaaccgacaggttgatgactgacatcttggatgctttggagatt
gttggcacttcgcaagccgacatgaaccacatcttcatcaacttctcgcacgtcttccca
ttgaatcctactgaggtcgaggaggctattggcggcttcttggagcgcttcggtcgacga
ctttggcgtctccgcgtcactggcgctgagatccgcatcattgtcaccgatcctcagact
ggcatcccgtacccactccgtgtcatcatcacgaacacttcgggctacgttattcaggtc
gagatgtacgctgagcgcaagtccgaaaaggctggcaagtggctgttccacagcatcggc
ggcaccaccaagattggctcgcttcacctccagcctgtctccacgccttatccgaccaag
ggtgctcttcagcccaagcgttacaaggctcatctcatgggtactcagtacgtatacgac
ttccccgagctgttccgacaagccaccgaaaacgcctggcaagcagccatcagcaagcac
tcttacctgcgcgacaagttgccgccgaagggagagtgcctcgagtactacgagctggtg
cttgatgagaatgacaacctcgctgaggtaaaccgtgaccctggcttcaacaccattggt
atggttggttggatcgttacggccaagacacccgagtacactcgtggacgtcgcttcatc
atcattgccaacgacatcactttcaagattggttcattcggtccccaggaagacgccttc
ttccacaagtgctcagagctcgcacgtaagctgggcatcccgcgtatctacctttctgcc
aactctggtgctcgtattggtctggctgaggagctcattccccacttctccgtcgcatgg
aaggacattgacaggccagaggctggctttgactacctctaccttacgcctgagaagtac
gggcatttcgtcgatggcaagcgtaacgatgtcatctgcgaaaagatccaggtagatgac
gagacgcgattcaagatcacgaccgtcattggtcaagaagatggtcttggtgttgagtcg
ctccgtggctctggtctcattgctggtgaaacatctagggcttacgaggatatcttcaca
atcactttggtgacttgccgttcagttggtatcggtgcttaccttgtccgtctcggtcaa
cgcgcgatccagattgagggtcagcctatcatcctcactggtgcacaggccatcaacaag
ctgctcggtcgcgaggtctatacttccaaccttcagctcggtggtactcaaatcatgtac
cgaaatggtgtgtcgcacatgactgccgacgatgactttgagggtgtttccaagattgtc
aagtggctgtcatacgtgcctgacaagaagggaagccctgttcccatctcacctactgct
gatgactgggaccgcgatgtcgcgtactacccgcctggtaagggaaccgcctacgacgtc
aggcaccttattgctggcaaaactgatgaggacggcttcctgcctggtctgttcgacaag
gactcttttgaggagtctcttggtggctgggccaagactgtagttgtcggacgtgcacgt
cttggtggtatccccatcggtgttattggtgttgagactcgctctgtcgagaacgtcaca
cccgccgatcctgccaaccccgactctattgagcaagtcacctcagaggctggtggtgtc
tggtaccccaactccgcctacaagacggcccaggctatcaacgacttcaaccacggcgag
cagctgccacttatgatcctcgccaactggcgtggtttctccggaggtcagcgcgacatg
tacaacgaagttctcaagtatggttcgtacattgtcgatgctcttgtcaatacatgggag
atgtacgcagacgaagactcgcgtggtggcgtcctcgagcccgagggtattgtcggcatc
aaataccgcaaggagaagcaactggagaccatggcgcgaaacgaccccacctatggtgca
ctcaaacgcaagctgaacgaccctgcgacaccaaaggaccagcttcaagccatcaagacg
cagatgaacgagcgcgagaagactcttctccccatctacggccagatcgctatccagttt
gctgatctccatgaccgcgctggccgcatgcaggccaagggtgtgatccgacaggccctg
cgatggcaaaatgcacgccgcttcttctactggcgccttcgccgccgtcttaacgaggag
tacatcatcaagaagcttgttgctgtcgcacctaccgaggacatcaccagcacccgtgcc
cgtggcctcgagatgctcaaggcatggtgcaacatccctaacttcgcaaccgacgatatg
agcgttgcgacatggtatgaggagaaccgacagaacgtccatgagcgcgtcctgaagctc
aaggccgagtcaacgtctctcaaggtcgcgcagatgattagcgaggaccgcgagagtggt
ctgcgaggtgtgatgaatctgctgagcacactgccaacagcagagaaggagcaggtgctc
aatatgctcagtagggcatag

DBGET integrated database retrieval system