KEGG   Phaeosphaeria nodorum: SNOG_02832Help
Entry
SNOG_02832        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pno  Phaeosphaeria nodorum
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pno00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MATKTAPPNGDGTMDRAHAADGQEKKVTVAATRRKTSPKKAKDGGLLASLCALVCDHQLG
ISLNLVALLSLTHVFFPRARSRTTKFLQMSYYNPETKMYGCGTDDLPFVLLWTVLFTAIR
VVVMEYLLDPLAKLGGIRSRKGLNRFKEQAWLIVYYTASWSLGMYIMYNSEFWLNLHGVW
EGWPFREVEGVFKWYYLVQWGFWIQQILVVNIEEKRKDYAQMFTHHIFTTALLFLSYGYY
HMRVGIVILSVMDFVDIILPTAKLLKYMGYTTACDIAFGVFVIAWLVTRHIIYMTICWSI
YYDAPRDMAPGCYFTPNHPSTPNSSYSLNANQLYIPMSDTAAFEAHGGNKPWSNLLRAYT
DQNGPICWNPNLRYYFLGLLLFLQALCCVWFSMVLRIVYKVLSGAGAEDVRSDDEDGEDE
EEEIEQDRTSTILNSVTTCTESGMSAMPKEEEVGVDALTFARLNGASQRRQQARRESARA
SGISLPGHGDRKELLGRIGCDKPS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaagacagcgccgccaaatggcgacggcaccatggacagagcacacgcagcc
gacgggcaagaaaagaaagtcacagtcgccgcgaccaggcggaagacgagccctaagaag
gccaaagacggggggctcctggcgtcgttgtgcgcattggtgtgcgatcaccagcttggc
atatccctaaacctcgttgccctcttgtcccttacacatgttttcttcccccgcgcgcgg
agtcgaaccaccaagttcctgcaaatgtcatactacaaccccgaaacaaaaatgtacggg
tgcggcaccgacgacttgcccttcgttctattgtggaccgtcctgttcacagcgatccga
gtggtggtcatggagtacctcctagacccgctggcgaaactcggaggcatccggtcgaga
aagggactgaacagattcaaggagcaagcttggctgatagtgtactacactgcatcatgg
tcgctcggcatgtacatcatgtacaattcggaattctggctcaatttgcacggtgtctgg
gaaggctggccttttcgagaggtcgagggcgtgttcaagtggtactacctcgtccaatgg
ggcttctggattcaacagatcctcgtggttaacatcgaagaaaagcgcaaggactatgcg
cagatgttcacacaccacatctttacgactgctctgttgttcctgtcatacgggtactac
cacatgcgagttggaatcgtcatcttgagcgttatggacttcgtagacattatccttcca
actgcgaaactcctcaaatacatgggctacaccaccgcctgcgacatcgcctttggagtc
ttcgtcatcgcctggctcgtcacccgccacattatctacatgacaatctgctggtccatc
tactatgacgccccccgcgacatggcacccggctgctacttcacgcccaaccacccctcc
acaccaaactcctcctacagcctgaacgcaaaccaactatacattcccatgtctgatacc
gcagcattcgaagcccatggtggcaacaaaccctggagcaatctgctcagagcatacacc
gaccagaacggaccaatctgctggaacccgaatctccgatactatttcctcggcctcctg
ctgttcctacaagcactgtgctgcgtctggttctccatggttcttaggattgtatacaaa
gtactttctggcgcaggcgcagaggacgtgcgttcagatgacgaagatggcgaagacgaa
gaagaggagatcgagcaggaccgcacatccaccatactcaactcggtaacgacatgcacg
gaatccggcatgagcgctatgcccaaggaagaagaggtcggcgttgacgcactcactttc
gcacgattgaacggcgccagccaaagacgccagcaagcacgacgcgaaagcgccagggca
agcggcatcagcctccccggccatggcgatcgtaaggagttgttagggcgcattgggtgc
gataagccatcgtag

DBGET integrated database retrieval system