KEGG   Phaeosphaeria nodorum: SNOG_02884Help
Entry
SNOG_02884        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SNOG_02884
Peptidases [BR:pno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SNOG_02884
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SNOG_02884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 769 aa AA seqDB search
MACTHVNAPGEHPAFAFSSDRNHSLLHVSTKNHPLVLNIKRTRKKVKRDEPPQKMTKLAI
AAETETDRYDTTTQVKCYECGVDDVDKSTGKLPDVVDAVLKANTFARQEEVKAWEQELTP
CEHTLCLEQEAARQIKSQSLGHCSECELNENLWLCLTCGNLGCGRQQYGGTGGNSHGVGH
TKTTGHPVAVKLGSLTADGTADIYCYACDEERVDPALPDHLAHWGINIKDRVKTEKSLTE
MQVEQNLRWEFSMVTEDGKELKPLFGPDFTGLKNLGNSCYLNSTLQALFAMPEFKDRYYL
PDEALPSTNQPAEDLETQLRKVADGLISGRYSKPDSDVFVSESSPEVPHQRGIAPAMLKH
LVGRGHPEFSTMRQQDAFELLLHLLKLVSRTQHVAPHKDPVDAFRFAMEQRLQCIGCKRV
RYRSDEQENISIPVPIRRIPKDAQMEVTDAAGKDAEQEKEEFESVSLKECLDIFTAEEMV
ELTCSACGSKDGFLKRSMFKTFPTVLAVNARRFELVNWVPTKQDVPVIVNDEPFSFDAYK
SHGLVNGEEVLPEDTDTGAASNKWVPNEAALSMLEAMGFPRIRCEKALHATGNEDPEAAS
NWLFAHMEDADIDDPVDSNAGSGSGGAAASATIDPEKIENLGAMGFSAPQARQALKETGG
DMERAVDWLFSHPDAQGDFDEGGSSEPPAEQQDKLLPGSDKLPANFQLQSIVCHKGSSIH
AGHYVAFVRKQLPDEQAPSWVLFNDEKVAKAADVEEMKKFAYVYFFRRL
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcacgcacgtcaacgcgcctggtgagcaccccgcatttgccttcagcagtgac
cggaaccactcactcctccacgtctccaccaagaatcatcctctcgtcctgaatatcaag
cgcacgcgaaagaaggtcaagcgcgatgagccgccgcagaagatgacaaagcttgcgatc
gcggctgaaaccgagaccgaccgctacgacaccacaacccaggtcaaatgctatgagtgt
ggcgttgatgacgtcgacaagagcactgggaagctaccagacgtggtcgacgctgtcctc
aaggcaaacacctttgcgcgccaggaggaggtcaaggcctgggagcaagagctgactcca
tgcgagcacacgctgtgcttggagcaggaagctgcacggcagatcaaatctcagagcctg
ggtcattgctcagagtgtgaactcaacgagaacctctggctgtgtctgacgtgcggtaat
ctaggctgcggccgtcaacaatatggcggcactggtggcaactctcatggtgtcggacat
acaaagaccacgggtcaccctgtggcagtcaagcttggctcccttacggctgatggaacg
gccgacatctactgctatgcatgtgatgaggagcgtgtcgatcctgcgttgcctgaccac
ctggctcattggggcatcaatatcaaggacagggtcaagacagagaagagtcttaccgag
atgcaggtcgaacagaacttgcgctgggagttctcgatggtcactgaggatggtaaagag
ctcaagccattgtttggcccagactttactggcctcaagaacctgggaaacagctgctac
ctgaacagcactttacaagccctattcgccatgcctgagttcaaagaccggtattacctg
ccagatgaagcgctgcccagcaccaaccagcccgctgaagatctggaaacccaattgcga
aaggtagcagatggcttgatctcgggtcgctactccaagccagatagcgacgtttttgtc
tccgagagctctcctgaagttccacatcagcgcggtatcgcaccagctatgctcaagcat
ctcgttggacgaggccatcccgagttctccactatgcgacaacaagatgccttcgagctg
cttttgcacttgctcaaacttgtttcgcgcacccagcacgttgcacctcacaaagacccg
gtggacgctttccgatttgcaatggaacagcgactgcagtgcattggttgcaaacgagta
cgctaccggtccgacgagcaagagaacatctctatccctgtcccgattcgaaggatacca
aaggatgcgcagatggaagtcaccgacgctgcaggtaaagatgcagagcaagagaaggaa
gagttcgagtccgtgtctttgaaggagtgtcttgacatattcaccgctgaggagatggtg
gagctcacctgcagtgcctgtggaagtaaggatggctttctgaagaggagcatgttcaag
accttcccgaccgtgttggctgtcaatgcccgccgatttgagctggtcaactgggttcca
actaagcaggatgtcccagtcattgtcaacgatgaacccttctcgttcgacgcctacaag
tctcacggcctggttaatggcgaggaagtcctaccagaagatacggatactggagcagcc
tcaaacaaatgggtgccaaacgaagctgcgttgtccatgctagaggccatgggtttccct
agaatcagatgcgaaaaggcactacatgcgactggaaatgaggaccctgaggcagcttcg
aactggctctttgcacacatggaggacgctgatatcgatgaccctgtagactccaacgca
ggcagtggctctggtggcgctgctgcttcagctactatagatcctgaaaagatcgagaac
ttgggcgccatgggcttcagtgctccacaggcgcgacaggctttgaaagagaccggtggc
gatatggaacgtgctgtggattggttgttttctcacccagatgcacagggcgactttgat
gagggcggcagctcagagccccccgcagagcagcaagacaagttacttccaggaagtgac
aagctgccagcaaacttccagctccagtccattgtgtgccacaagggcagctcaattcat
gctggtcattacgttgcgtttgttcgcaagcagttgccagacgagcaagctccatcatgg
gtcctcttcaacgacgaaaaggttgccaaagcagctgacgtagaggagatgaagaagttt
gcatatgtgtatttcttccggcgtttgtga

DBGET integrated database retrieval system