KEGG   Parastagonospora nodorum: SNOG_03052Help
Entry
SNOG_03052        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00220  Arginine biosynthesis
pno00330  Arginine and proline metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01230  Biosynthesis of amino acids
Module
pno_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SNOG_03052
   00330 Arginine and proline metabolism
    SNOG_03052
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SNOG_03052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5970498
NCBI-ProteinID: XP_001793641
UniProt: Q0UYW2
Position
Unknown
AA seq 324 aa AA seqDB search
MTAPPPHQAKFLPDRHDLGVVAVGFSGGQPKPGVDAAPMALIEAGLIQQLEHDLEMNVSY
DGTVHNYSELLPSDDPDYRGMKRPKFASAVTQSVSAQVYAHAVSGKMVLTLGGDHSIAIG
TISGTAKAVRERLGREIAVIWVDAHADINTPETSDSGNIHGMPVSFLTGLAKEGREDVFG
WIKEEHLLSTKKLVYIGLRDIDKGEKKILREHGIKAFSMHDVDRHGIGKIMDMALAWIGM
DTPIHLSFDIDALDPMYAPSTGTAVRGGLTLREGDFICECVAETGSLIALDLVEVNPSLD
EQGASDTVRAGLSIVRCALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccctcctccacaccaagcaaagttcctccctgaccgccatgacttgggcgtc
gtcgcagtcggcttcagtggcggccaacccaaacccggcgtcgacgccgccccaatggcc
ctcatcgaagccggcctaatccagcaactcgagcacgacctcgaaatgaacgtcagctac
gatggcaccgtgcacaactactccgaactcctcccctccgacgacccagactaccgcggc
atgaagcgcccgaaattcgccagcgcggtaacccaatctgtcagcgcgcaagtctacgcg
cacgccgtgtccgggaaaatggtgctcacgctcggcggcgaccacagcatagctattggc
acgatcagcgggacggcgaaggcggtgcgcgagcggctggggcgcgaaatcgccgtcatc
tgggtcgatgcgcatgctgatatcaacacacctgagacgtcagatagtgggaatattcac
ggcatgcctgtgtcgtttttgacggggctggcgaaggagggccgcgaggatgtgtttggg
tggatcaaggaggagcacttgctgagcacgaagaaacttgtgtatattgggctgagggat
attgataagggggagaagaagattctgagggagcacgggatcaaggcgttttcgatgcat
gatgttgatagacatggtattggcaagatcatggatatggcgttggcttggatcggcatg
gatacgcctattcacctgtcgttcgatatcgatgcgctggatcctatgtatgcgcctagc
acgggtacggctgtacgaggcggtctcactctgcgcgagggcgacttcatctgcgagtgt
gtcgcggagactggatcgctcatcgctctggatcttgtcgaagtcaacccaagccttgac
gagcagggcgcaagcgacactgtacgcgctggtttgtcgatcgttaggtgtgcgctcgga
gacacacttttgtaa

DBGET integrated database retrieval system