KEGG   Phaeosphaeria nodorum: SNOG_03052Help
Entry
SNOG_03052        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pno01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pno00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MTAPPPHQAKFLPDRHDLGVVAVGFSGGQPKPGVDAAPMALIEAGLIQQLEHDLEMNVSY
DGTVHNYSELLPSDDPDYRGMKRPKFASAVTQSVSAQVYAHAVSGKMVLTLGGDHSIAIG
TISGTAKAVRERLGREIAVIWVDAHADINTPETSDSGNIHGMPVSFLTGLAKEGREDVFG
WIKEEHLLSTKKLVYIGLRDIDKGEKKILREHGIKAFSMHDVDRHGIGKIMDMALAWIGM
DTPIHLSFDIDALDPMYAPSTGTAVRGGLTLREGDFICECVAETGSLIALDLVEVNPSLD
EQGASDTVRAGLSIVRCALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccctcctccacaccaagcaaagttcctccctgaccgccatgacttgggcgtc
gtcgcagtcggcttcagtggcggccaacccaaacccggcgtcgacgccgccccaatggcc
ctcatcgaagccggcctaatccagcaactcgagcacgacctcgaaatgaacgtcagctac
gatggcaccgtgcacaactactccgaactcctcccctccgacgacccagactaccgcggc
atgaagcgcccgaaattcgccagcgcggtaacccaatctgtcagcgcgcaagtctacgcg
cacgccgtgtccgggaaaatggtgctcacgctcggcggcgaccacagcatagctattggc
acgatcagcgggacggcgaaggcggtgcgcgagcggctggggcgcgaaatcgccgtcatc
tgggtcgatgcgcatgctgatatcaacacacctgagacgtcagatagtgggaatattcac
ggcatgcctgtgtcgtttttgacggggctggcgaaggagggccgcgaggatgtgtttggg
tggatcaaggaggagcacttgctgagcacgaagaaacttgtgtatattgggctgagggat
attgataagggggagaagaagattctgagggagcacgggatcaaggcgttttcgatgcat
gatgttgatagacatggtattggcaagatcatggatatggcgttggcttggatcggcatg
gatacgcctattcacctgtcgttcgatatcgatgcgctggatcctatgtatgcgcctagc
acgggtacggctgtacgaggcggtctcactctgcgcgagggcgacttcatctgcgagtgt
gtcgcggagactggatcgctcatcgctctggatcttgtcgaagtcaacccaagccttgac
gagcagggcgcaagcgacactgtacgcgctggtttgtcgatcgttaggtgtgcgctcgga
gacacacttttgtaa

DBGET integrated database retrieval system