KEGG   Phaeosphaeria nodorum: SNOG_03095Help
Entry
SNOG_03095        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pno  Phaeosphaeria nodorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SNOG_03095
Enzymes [BR:pno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SNOG_03095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 709 aa AA seqDB search
MAEQSRGKIPILLLKTKSAPRDTYEELFRNLDDHRYTPVFVPVLEHRFRRDALDEVRKHV
TGRGFVPKAKGGLATYGALIFTSQRAVEAFADIVEELRKAGNHVDDLLPDSLPLYVVGPA
TARGLRSLDLKCPILGDETGNGEALATYMLEHYNNLYPGAGKPSLLFLVGDKRRDIIPKT
LQAEELGDERRCRVDELVIYETGEMQSFKEEFSTLWRKNADAGCERQWVVVFSPTGCKAM
LESLDLLDKQTGRAKSSARNGLNIATIGPTTRDYLQHEFGFQPDVCAERPSPEGIADGTR
SSPRNAGSSPAKNDDAVAGSKRKPEAEPSPNRGRKASKKQATLEETGITNEDSEMKDATN
GGDAKESEAETKDDAPKAQEDEENTSDEKDVSDGTAKVETTKDDVKAEANDDAAKPDAAN
GEGAVEQSSQREKEVPSNILEKGLIYFFTRNRVGIDDAESVGDLQRTFFVLRPLPTGAKL
GEGAIPDLKNNRLFALPKKTFPKSHTDRFMAFVEKANTTIQDLKDNFFKGSEYETKTQGT
RQVDPVTPVAEGVYAITRTEDRTTHLVYSTTIPSDLGEVQEDLGIKDQGSFIISVKNPER
SGPASAQLAQKPDFSKEIIEEFRGLAWSEVKPKYIDHEYCQILLIGEQLDSGVEPTTKDK
KHDKETPQEELEKLEHEDELRVEHLHGDDSIFDDLKISKKDYPKVPTTW
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaatcacggggcaagattcccatcttgctcctcaagacaaagtcggcgcca
agagacacatacgaggagctctttaggaacctagacgaccatcggtacacacctgtcttc
gttcccgtcctggaacatcgcttcaggcgagatgcactggacgaagtgcggaagcatgtt
actggtcgcggcttcgtaccgaaagcgaaaggtggccttgcgacatatggggccctaatt
ttcacttcccagcgcgctgtggaagccttcgctgacattgtcgaggagcttcgaaaagct
ggaaatcatgtcgacgatctcctcccggacagtctcccattgtatgtcgtgggaccggca
actgcgcgtggattgaggtcgttagatttgaaatgcccaatcctcggcgacgagactggc
aatggagaagctctggcgacatatatgctcgagcactacaataatctgtaccctggtgct
ggaaagccgtcgctgttatttctcgtcggtgataagaggcgggacatcattcccaagacg
ctgcaggcagaagagctcggtgatgagagaagatgcagagtggatgaactggttatatac
gagacgggtgagatgcagtccttcaaagaagaattctccacgctgtggcgcaagaacgcg
gacgctggctgcgaacggcagtgggtcgtagtgttctccccaaccggatgcaaggcgatg
ctggaaagtttagacctcctcgacaaacagacagggcgtgcgaagtcttctgctcgaaac
ggcctcaacattgcgacaattggcccaacgactcgcgactatcttcaacacgagtttggc
tttcagccagacgtctgcgcagagaggccaagtccagaaggcatagcggacggaacacgc
tcttcgccgcgcaacgctggatcgagcccagcgaagaatgatgatgcagttgctggatcg
aagagaaagcctgaggctgagccgtcgccaaatcggggtcgcaaagcctccaaaaagcaa
gccacgcttgaggaaacaggtatcacgaacgaagatagtgagatgaaggatgccaccaac
ggtggtgacgcgaaggagagtgaagcagagacgaaagacgacgctcccaaggcccaggaa
gacgaagaaaacacgagtgacgagaaagatgtgtctgatggcactgcaaaggtagaaaca
acgaaggatgacgtgaaggcagaggccaacgatgatgcggccaaaccagacgcggccaac
ggagagggtgccgttgaacagtcctcgcagcgcgagaaggaagtaccctccaacatccta
gagaaaggtctcatctacttcttcacccgtaaccgcgtcggcatcgacgatgcggagagc
gtgggtgacctacagcggactttcttcgtgctgaggccgcttccaaccggagccaagctg
ggcgagggtgccattccagacctcaagaacaaccgtctgttcgccttacccaagaaaaca
tttcccaagtcgcacaccgatcggttcatggcgtttgtggagaaggccaacaccacgatc
caagacctgaaggacaacttcttcaaaggcagtgagtacgagactaagacgcaaggcaca
cgacaggtggatccagtcactcctgtcgccgaaggcgtgtacgccataactcggaccgaa
gatagaactacccatctggtctactccactactattccatctgatctcggtgaagtccaa
gaggatctgggaatcaaggatcagggaagcttcatcatcagcgtcaaaaacccagagcgc
agtggtccagcatctgctcaattggcacagaagcccgacttctccaaagaaatcatcgaa
gagtttcgcggtctagcatggtccgaggtcaaacccaagtatatcgaccacgaatactgt
cagattctgcttatcggagagcaacttgatagtggcgtcgagcccaccacaaaggataag
aagcacgacaaggagacgccgcaagaggagcttgagaagcttgagcacgaggatgaactt
cgtgttgaacacctgcatggcgacgactccatcttcgacgacctcaagatctccaagaag
gactatcccaaggtcccgaccacctggtag

DBGET integrated database retrieval system