KEGG   Phaeosphaeria nodorum: SNOG_03507Help
Entry
SNOG_03507        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
pno  Phaeosphaeria nodorum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pno00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    SNOG_03507
Exosome [BR:pno04147]
 Exosomal proteins
  Proteins found in most exosomes
   SNOG_03507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1589 aa AA seqDB search
MASKPIPLHVAQPTLLTNLNITTLESDKYVCVRQVNSEANAPAETVIIDLKNTNNIIRRP
IRADSAIMHLTEPIIALKAQGRTLQLFNLETKERLQTYSHQEDIQFWRWVSQTTLALVST
KAVYHWDVLDSKNSAAPRKIFDRGEQLENNQIINYVTNDDESWSCLVGITSNPAGGIRGN
MQLFSKARNVSQPLEGHAATFGTIRLDGAATYTKLFAFAVKSTSGEAKINIVVECDHNAS
NPAFPKRLIPIHWPAEGTGDFPLGIHIAHKYGILIVITKFGFIHLHDLETGTALFLNRIS
EETVFTTARDDDGTGVVVINKRGQVLHTTIREDALIPYIMENPACAEIAYKLASKGGLPG
ADQLYSQRFENLMTQGNFAEAAKVAANSPRGFLRTMNTINRLRQVPSQPGQITTLLQYFG
QLLDKGGLNREETLELARPVFVQGRKHLIEKWQKEGKLFCSEELGDLAKPHDLNLALAIY
KDKVVAALAELGHYDLILQYCNGVGYTPDYNVLLQHVVRSNGEKGTEFASQLVKNEGGPL
ISIDRVVDIFQSQGMIQQATAFLLDVLSNDLPEEGHMQTKLLEMNLLNAPQVADAILGNE
MFHHYDKARIASLCENAGLLTRALEHNEDPAAVKRIIVQTDKLPEEWLINYFGQLTVELS
LDCLDAMLTTNIRQNLQAVIRIAQKYSDLLGATKIIDLLEKHRTAEGLYFFLGSIVNVAE
DKDVTFKYIEAATTMGQLNEVERVCRESNAYDPEKVKNFLKEANLTEQLPLIIVCDRFNF
IHDLVLYLYKKQQFKSIEVYVQRVNPARTPAVIGGLLDVDCDESIIKGLLASVTPSSIPI
DELVSEVESRNRLKLLLPFLEQTLASGNQQQAVYNALAKIYIDSNNNPEKFLKENDQLKL
VTLLERADSEIWDYVLSPNNMHRRSLVDQVTSTAVPSSTDPDKVSVAVKAFITGDMPAEL
IDLLEKIILEPSSFSDNPSLQNLLMLTAAKSDRGRMMDYIHQLEHYTPEDIAQQCIEVGM
YEEAFEIYKKHGQHFDAANVLIEHVVSIDRAQEYAERVETPEVWSRVAKAQLDGLRVTDS
IESYIRAGDPSNFLEVIEIATHAGKDEDLIKFLRMARKTLREVPVDTALAFCFARTNQLP
ELDEFLRGTNVADVEASGDKAYEEGYHEAAKIFYTSISNWAKLATTLVHLDDYQAAVECA
RKANSVKVWRQVNQHCIDKKEFRLAQICGLNLIVHAEELAELVKQYERNGYFDELISLLE
AGLAIQACEAAHLWPELIFLYVHYDEWDNAALAMMERAADAWEHQAFKDTIVKATNVEIY
YRALGFYLEEQPTLLTDLLQALTPRIDVNRVVRMFVKSDNIPLIKPFLLNVQSQNKREVN
NALNDLLIEEEDYKTLRDSVNNYDNYDPVDLAQRLEKHDLVFFRQIAADIYRKNKRWEKS
IALSKQDKLFKDAIETSAMSTKSEIVEDLLRYFVDIGSRECYVGMLYACYDLIRPDVILE
MSWRHGLHDFTMPYMINLLSQQTAALTGLQKDNEERKAREASQQKKEEDTPILGSRLMLT
QGPIASAPSPGPYGQANGIAPQPTGYRGF
NT seq 4770 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaaccgattccattgcacgtcgcgcagccgacgctgctcacgaacctgaac
atcaccacgctcgagtccgacaagtacgtttgcgtgcgccaggtcaacagcgaagccaac
gcacccgccgagacggttatcatcgatctgaagaacacaaacaacattatccgaagaccg
atacgcgccgacagcgccatcatgcacttgactgagcccatcatagctctcaaggcgcag
ggccggacgctgcagttgttcaacctcgagaccaaggagcgcctacagacatacagccat
caagaggacatccagttctggagatgggtcagccagacgacccttgcgcttgtcagcaca
aaggccgtgtaccattgggatgtactcgattcgaagaactctgcggcaccacgcaaaatc
ttcgaccgcggagagcagctcgagaacaaccaaatcatcaactatgtcaccaacgacgat
gagagctggtcctgcttagttggtattacctcaaacccggcgggtggcattcgcggcaac
atgcagttgttttccaaggccaggaacgtcagccagcctctcgagggccacgcagccaca
tttggcaccattcgtctcgacggcgctgccacctataccaaactctttgcgttcgccgtc
aaatcaacgtccggagaagccaagatcaacatagttgtagagtgcgaccacaatgcctcg
aacccggccttcccaaagcgattgatcccaatccactggcctgctgagggtactggcgat
ttcccgctcggcatccacattgcgcacaagtacggcatcctaatcgtaatcacaaagttc
ggtttcatccatcttcatgatctcgagactggtacagccctgttcctgaacaggatctcg
gaggaaacagtcttcacaactgcccgcgacgatgatggcactggtgtagttgtgatcaac
aagcgcggacaggttctccacactaccattcgcgaggatgctttgatcccgtacattatg
gagaacccagcatgtgcagagatcgcgtacaagctcgcttccaagggtggacttccggga
gctgatcagctatactcacaacgattcgagaatctgatgacacagggcaacttcgccgaa
gcggcaaaggtcgcggccaactccccacgaggcttcctgcgcacaatgaacaccatcaac
aggctgcgacaagtgccgtcccagccaggtcagatcacaactttgctgcagtacttcggc
cagttattggacaaaggtggattgaaccgggaagagactctggagctggcacgaccagtt
ttcgtgcaaggccgcaagcacttgatagagaagtggcagaaggagggcaagcttttctgc
tcagaagagcttggagaccttgcgaaaccccacgacctgaaccttgctctggccatctac
aaggacaaggtcgttgctgctctagctgagctcggccactacgacctcatcctccaatac
tgcaacggcgttggctacacgccggactacaacgttctgcttcaacacgtagtcaggagc
aacggagagaagggaacagagtttgcttcacaacttgtgaagaacgagggtggaccactc
attagcatcgatcgtgttgtcgacatcttccagtctcagggcatgatccaacaagctact
gcattccttcttgatgtgctgtccaacgacctgccagaggaaggccatatgcaaacgaag
cttttggagatgaacttgctcaacgcaccccaagtcgcggatgctatccttggaaacgag
atgttccaccactatgacaaggctcgcattgcctccctctgcgagaacgccggcttgctc
acccgtgctctggagcataacgaggaccctgccgctgtcaagcgcattatcgtccagact
gacaagctgcctgaggaatggttgatcaactactttggtcagcttaccgttgagctttcc
ctcgattgcctcgacgcaatgctcacgacgaacatccgacaaaacctgcaggctgtcatt
cgcatcgcgcagaagtactcagacctgctcggtgccaccaagatcatcgatctcctagaa
aagcacaggactgccgagggattatatttctttcttggcagtattgtcaatgtggccgag
gacaaggatgtcaccttcaaatacattgaagctgccacgaccatgggtcagctgaacgag
gttgagcgtgtttgccgagagagcaacgcctacgacccagaaaaggtcaagaacttcctc
aaagaggccaaccttacagagcagcttcctttgatcatcgtttgtgatcgattcaacttc
atccacgacttggttctctacctctacaagaagcaacagttcaagtctatcgaggtttac
gtacagcgtgtcaacccagccaggacacctgcagtcatcggtggattgctcgacgtcgac
tgcgatgaaagcatcatcaagggcctattggcctccgtgaccccctcatcgattcccatc
gacgagttggtcagtgaagtcgagtcacgcaaccgcttgaagctcctccttcccttcttg
gagcagaccttggccagcggtaaccagcaacaagctgtgtacaacgccctcgctaagatc
tacattgactccaacaacaaccccgagaagttcttgaaggagaatgaccagctcaagctc
gttaccctgctcgagcgcgctgattcggagatctgggactacgtactgtctcccaacaac
atgcacagacgatcgttggtcgaccaggtcacttcgaccgctgtaccttcttctaccgac
cccgacaaggtgtctgtggctgtcaaggccttcatcactggcgacatgcctgcggagctc
atcgacctgctcgagaagatcatcttggagccctctagcttcagcgacaacccgtctctg
cagaatctgctcatgcttaccgctgccaagtctgaccgtggccgtatgatggattacatc
caccagctcgagcactacacacccgaggacattgctcagcagtgtatcgaggtcggcatg
tatgaagaggctttcgagatctacaagaaacacgggcagcactttgatgctgccaacgtt
ctcatcgagcacgtcgtctccatcgatcgcgcacaagagtatgccgagcgcgtcgagacg
cccgaagtgtggagcagagttgccaaagcacaattggacggcctgcgtgtgactgattct
attgaatcctacatccgcgccggtgacccatccaacttcctggaggtcatcgagatcgct
acccacgccggaaaggatgaggacctgatcaagtttttgaggatggcacgcaagacactg
cgcgaggtccctgtcgacactgcccttgctttctgctttgctcgtactaaccagcttccg
gagctcgacgagttcctccgtggaacgaacgtcgcagatgtagaggcatccggtgacaag
gcatacgaggagggctaccatgaggctgccaagatcttctacaccagcatctccaactgg
gccaagcttgcgactacgctcgtccaccttgatgattaccaagctgctgtcgagtgtgct
cgcaaggccaacagcgtcaaggtttggaggcaggtgaaccagcactgtattgataagaag
gagttccgtcttgcacaaatctgtggtctcaacctcattgttcatgccgaggagcttgcc
gagcttgtgaagcagtatgagcgcaacggctactttgatgagctcatcagccttctcgag
gctggtcttgccatccaagcttgcgaggccgcgcacctttggccagagctgatcttcctc
tacgttcactacgatgaatgggataatgcagcattggccatgatggagcgtgccgcagat
gcatgggagcaccaagctttcaaagatactatcgtcaaggccacgaatgtcgagatctac
taccgcgccctgggcttctatcttgaggaacaacctacgctgttgaccgatcttctgcaa
gcccttacaccgaggatcgatgtcaaccgtgttgtccgcatgttcgtcaagtcggacaac
attcccctgatcaagcccttcctcctgaatgtccaatcacagaacaagcgtgaggtcaac
aatgccctcaacgaccttctgatcgaagaggaggactacaagacactgcgcgactcggtc
aacaactacgacaactatgaccctgtcgatcttgcccagcgccttgagaagcacgacctc
gtcttcttccgccagattgccgcagatatctaccgcaagaacaagcgatgggagaagtca
attgctctgtccaagcaggacaagctcttcaaggatgctatcgagacctccgccatgtcc
accaagtcggagattgtcgaagacctgctgcgatacttcgtcgacatcggcagccgcgag
tgctatgtcggcatgctctacgcttgctacgacttgatccgcccagatgtcattctcgag
atgtcatggcgccacggtcttcacgacttcacgatgccatacatgatcaacctgctctct
caacagaccgcagcacttacgggtctgcagaaggacaatgaggagcgcaaggctcgcgaa
gcctcgcagcagaagaaggaggaagacacgcccatcctgggatcgcgtctcatgctcact
caaggtcccattgcttcggcgccttctcctggcccttacggccaggccaacggcattgct
ccccagcccacgggctaccgtggcttctag

DBGET integrated database retrieval system