KEGG   Phaeosphaeria nodorum: SNOG_03575Help
Entry
SNOG_03575        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pno  Phaeosphaeria nodorum
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SNOG_03575
Enzymes [BR:pno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     SNOG_03575
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SNOG_03575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MGSFDQSKAYAAQETEGQFFDDGREVELLHFVYGHKNIEKIRGSPQNVLAAIDEYGRTKK
YLMNVGEDKGRIVTDLIAEVKPKTMTDQVELGGYVGYSCILFGEAVRKAGGQRYFSLERD
PAFAAVIMSLVDLAGLSDTVKVIVGSSDESIARLTSSGQIKHIDLMFLDHYKPAYTTDLK
LCEELGLITKGSVLAADNVIKPGNPPYLEYVRSSVEEKVKKAKLGGDSHTNGIAETNVKM
YESRYGKANFSNSKGNPNLVYESKLNNSYEPTGEPDGIEITRCVG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcttcgatcaaagcaaggcgtacgcagcacaggagacggaaggccagtttttc
gacgatggccgtgaggtagagcttctccactttgtctacggacacaagaacatcgagaaa
atacgcgggtcgccgcagaatgtcctggctgctattgacgagtatggaaggacaaagaag
tatctcatgaacgttggagaggacaaggggcgcatagtcacagatctgatcgcagaagtg
aagccgaaaacaatgacagaccaggtcgagctcggcggctacgtaggctactcatgcatc
ctctttggagaagccgtacgaaaagcaggcgggcagcgatacttcagcttagagcgcgat
cccgccttcgccgcagtgatcatgtccctagtcgacctagccggcctttcagacaccgtc
aaagtgatcgtaggctccagcgacgagtcaatcgcacgcttaacctcctctggccagatc
aaacacatcgacttgatgttcctagaccactacaagccggcctacaccacggacctgaaa
ctctgcgaagagctgggcttgattacgaagggctcggtgctcgcggctgacaatgtcatc
aagcctggaaacccgccgtatctggagtatgtacggtcgagtgttgaggagaaggtgaag
aaggcgaagctgggtggggatagtcataccaatggcattgcagagacaaatgtcaagatg
tatgagtcgcggtatggaaaggcgaatttcagcaacagtaaggggaacccgaacctggtg
tatgagagcaagttgaacaatagctatgagccgacgggcgaacctgacggtatcgaaatc
accagatgcgttggttag

DBGET integrated database retrieval system