KEGG   Phaeosphaeria nodorum: SNOG_03601Help
Entry
SNOG_03601        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pno  Phaeosphaeria nodorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pno00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1563 aa AA seqDB search
MQSLANKLVNLATSAPSDSPSDPASQTVYLLPLTDSGAPDVPGTYIYLPPPTEPAYSVRF
QIQGTSSICRKGSLWVNIPAKGEKFDRSKYREYKLKPDFNGTTEIDVPVYAANAFSFYTT
YSPLPQWSFTDVASPEPTRTSTYYIDVCPRLTLQGKQLPVESVIVFSTLSKFMGEYPTDW
DNHLRGISQRGYNMVHFTPLMIRGESNSPYSIYSQLEFDKAVFPKGEADVAAMVEKMHTE
FSMLAMTDVVWNHTANNSKWLEEHPESGYNVDTAPHLQPALELDTALLKFGKELSSYGLP
TKFESEADLVKVMESVKENVLSKLKLWEYYVVDVERDAQAIMEKWKAGQATFPEGSFSEA
GLRGLDAVKGWPLKQKADWLVDHALLGGDRMGERFRRRIDPAAGAGLLCALFGRFDSRTS
DTPDERAASDECTRILQELNLPFYKEYDGDAKEIMEQLFNRIKYVRIDAHGPKLGEVNEK
NPLIETYFTRLPLNDTTKKHNPEALALVNNGWVWAADAMRDNAGPKSRAYLRREVIVWGD
CVKLRYGSGPEDNPFLWEHMAKYTRLMAKYFQGFRIDNCHSTPIHLAEYMLDQARHVNPN
LFVCAELFSGSEEMDYKFVMRLGISCLIREAMQAWSTQELSRLVHRHGGIPIGSFETDEV
LNADQDGTKSHAIVKKIKRSPVHALFMDCTHDNEMPAQKRDARDTLPTAALVAMCSCATG
SVFGFDEVYPELIELVHEKRLYSSTNSTGGPIKAQAGEGGIGGVRKIINEIHVKMGQEEY
TETYIHHDQEYITVHRVDPHTRKGYFLIAHTAFPGYGNGNGGFGQTNLPGTQAKLIGAWN
LDVDNSQETRARVIGDKTTLRGLPARTNNLQGVKIETTGDSTTISIPDKFPPGSIALFET
SVASAEHADGLDKYVTTGARAAFKDVNLADLNFILYRCDAEEQNDSDGKDGTYDIPGHGK
LVYAGLQGWWSPLRDIVNDNNLGHPICKHLREGQWALDYCVGRLERAGSKGQYSRVKEPA
KWLKERFDAIRKLPSFMLPRYFALVIQAAYNAAIDRAIELMGENVRNGNNFLKSLALVSV
QVTGYVKGASIWPEKNVPSMAAGLPHFAVSWARCWGRDITISARGLFMATERYDDAKEHI
MCFASVLKHGMVPNLLGSGVNPRYNSRDSVWWFLQNIQDYTKIVPNGLDLLQEKAPRRFL
PYDDTWFPHNDKRAYSVHSTIEDVIQEALQRHASGIEFREYDAGPNIDSQMKPEGFDIKI
WTDWENGLIFGGNQWNCGTWMDKMGESEKANSKGVPGTPRDGAPIEMIGMLYSAVRWCSQ
LYEQGKFKYEGVTLPDGKETITYKAWADKIKANFERAFYVPRTPEEDKDYDVNTKIVNRR
GIYKDLYRSGKEYEDYQLRPNFPVAMAVAPDMFDPDHARYALQMADRVLLGPQGMKTLDP
SDLNYRGYYINSEDSTDFHTSKGRNYHQGPEWLWPTGFFLRALLKFDLQRRKTPEERVES
YQQVTRRLAGCMKAIQESPWAGLTELTQKDGDFCGDSSPTQSWSASCIIDLFQDAREYEL
DKA
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccctcgctaacaaattggtcaacctggccacgtctgcgccgtcggattctccc
tccgatccggcttcgcagacagtgtacctgctgccattgaccgactccggcgcgccagac
gtgccgggcacatacatttacctgccgcctccaaccgagccggcatactctgtccgcttc
cagatccagggtaccagctcgatatgtcgtaaaggcagtctctgggtgaacatcccggcc
aagggcgagaagttcgaccgcagcaagtatcgcgagtacaagctcaagccagacttcaac
ggcaccacggaaatcgacgtacccgtatacgctgccaatgccttctcattctacacaacc
tactcgccgctcccacaatggtcgttcaccgacgttgcatcaccagaacccacgcgaaca
tccacatactacatcgatgtatgtccgagactcaccctccagggcaagcaattgcccgtc
gagagcgtcattgtcttctccacgctgtccaaattcatgggcgagtaccccacagattgg
gataaccatctacgcggcattagtcaacgcggctacaacatggttcatttcacacccctc
atgatccgtggcgagtcgaattctccctacagcatatatagtcagctcgaatttgacaaa
gctgtctttcccaagggcgaagcggatgtcgcggccatggtcgagaagatgcacactgag
ttcagcatgcttgccatgaccgacgttgtgtggaaccacacagctaacaacagcaaatgg
ctcgaagagcacccagagtcaggttacaacgtcgatactgcaccccacctgcagccagct
ctcgagctggacacggcgctcctgaaattcggcaaggagctgtcttcgtacgggcttcct
accaaattcgagagtgaggccgacctcgtcaaggtcatggagagcgtcaaagagaatgtg
cttagcaagctcaagctgtgggaatactatgttgtggacgtggaaagggacgcccaggca
atcatggagaagtggaaagccggccaagccactttccccgaaggcagctttagtgaagct
ggtcttcgtggcctcgatgccgtcaaaggctggccgctgaagcagaaggccgactggctc
gtcgaccacgcgcttctcgggggcgacaggatgggcgagcggtttaggcgccgcatcgac
ccagctgctggagctggtctcctgtgcgctcttttcggtcgcttcgacagccgtactagt
gataccccagacgagcgcgctgcatcagacgagtgcactcgcatcttgcaagagctcaat
ctaccattctacaaggagtatgatggagacgcgaaggagatcatggagcaactcttcaac
cggatcaagtatgtccggatagatgcccatggtcccaagctcggtgaagtcaacgagaag
aacccgctgatcgagacgtacttcacccgtctgccgctcaacgataccaccaagaagcac
aacccggaagcgctcgcgcttgtgaacaacggctgggtctgggccgccgatgccatgcga
gataacgctggtcccaagtcgcgcgcatacctaaggagagaagtcattgtttggggcgac
tgtgtcaagctccgatacggatctggcccagaggacaatcctttcctttgggagcacatg
gccaagtacaccaggctgatggcaaagtacttccaaggtttccgaatcgacaactgccac
tcaacccccatccatctggccgagtacatgctcgaccaagccaggcacgtcaaccccaac
ctcttcgtctgcgcagagctgttctctggttccgaagagatggactacaagtttgtcatg
cgcctcggcatttcttgtcttatacgagaggccatgcaggcctggagtacacaggagttg
agcagacttgtacaccgtcatggtggtattcccattggcagcttcgagacagacgaggtc
ctcaatgccgaccaagacggcacaaagtcgcacgctattgtcaagaagatcaaacgtagt
cctgtacatgcactgttcatggattgtactcacgacaacgagatgcctgcacagaagcgc
gacgctcgtgacacgcttccgactgctgctctggtcgccatgtgctcttgcgccactggg
agtgtgttcggcttcgatgaagtctatcccgagctcattgagcttgtccacgagaagcga
ctctattcttcgaccaactcaaccggcggccccattaaggcgcaagctggtgagggtggt
attggaggtgtccggaagatcatcaacgaaatccatgtaaaaatgggccaagaggagtac
actgagacgtacatccaccacgaccaggagtacatcactgtccatcgtgtcgacccccac
accaggaagggctacttcttgattgcacacactgcattccctggatatgggaacggtaat
ggaggctttggtcagacaaatctgccaggcacgcaagcaaagctcatcggcgcttggaat
ctggatgtcgataacagccaagagaccagggctcgtgtcattggcgacaagactacactg
cgcggccttcctgccaggacgaacaaccttcaaggagtgaagattgagactaccggcgac
tcgaccacgatcagcatcccagacaagttccctcctggtagcattgcgctctttgagact
tcggtagcgagcgctgagcacgccgatggccttgacaagtatgtaacgaccggagcgagg
gcagccttcaaggacgtcaacttggccgacctcaacttcatcctgtaccgttgcgacgca
gaggagcagaatgactctgacggcaaggacggaacctacgacatcccaggtcatggcaag
cttgtatatgccggcttgcaaggctggtggagtccactgcgcgacatcgtcaacgacaac
aacttgggccacccgatctgcaaacatctccgcgaaggtcaatgggccttggactactgc
gtcggacgtcttgagcgcgctggatcgaagggacagtattcccgcgttaaggaacccgcc
aaatggctcaaagaacgatttgatgctatccgcaagctgccgagcttcatgcttccgcga
tacttcgcgctcgttatccaggctgcttataacgccgcgattgaccgtgcaattgagctc
atgggcgaaaatgtacgcaacggcaacaacttcctgaagagtctcgccctcgtcagcgtc
caagtaacaggttacgtgaaaggtgcttctatctggccggagaagaacgtacccagtatg
gctgctggccttcctcactttgcagtcagctgggccagatgctggggtcgtgatatcacg
atctcagcccgtggtcttttcatggccacagaaaggtatgatgatgccaaggagcacatt
atgtgcttcgcaagtgttctcaagcacggcatggtacccaacctcctaggatctggcgtg
aacccgcgatacaactcccgagattcggtctggtggttcttgcagaacattcaggactac
accaagattgtgccgaacggtcttgatctgctccaggagaaagctccacgacgcttcctc
ccttacgatgacacctggttccctcacaacgacaagcgagcttactcggtacactccacg
atcgaggatgtgatccaagaagcattacaacgacacgcttccggaatagaattccgtgag
tacgatgctggccctaacatcgatagccagatgaagccagagggtttcgatatcaagatc
tggaccgactgggagaatggtctcatcttcggcggtaaccagtggaattgtggaacctgg
atggacaagatgggcgaaagcgagaaggccaacagcaagggtgttcctggcacaccccgt
gacggcgcacctattgagatgatcggcatgctgtacagcgctgtccgctggtgctcccag
ctgtacgagcagggcaagttcaagtatgagggtgtgacattgcccgatggcaaggagacc
atcacgtacaaagcgtgggccgacaagatcaaggcaaacttcgagcgcgccttctacgtt
cctcggactccagaagaggacaaggactacgatgtcaacaccaagatcgtcaaccgtcgt
ggcatctacaaggatctgtaccgatccggaaaagagtatgaggactaccagctgcggccc
aacttccctgtcgccatggcggttgctccggatatgttcgatcctgatcatgctcggtac
gcactgcagatggccgatcgtgttctgctcggaccacaaggcatgaagacgctggatcct
tctgatctcaactaccgcgggtactacatcaacagcgaagactcgaccgacttccatacg
tccaagggcaggaactaccaccaaggccctgaatggctctggccaacaggtttcttcctc
cgagccctcctcaagtttgaccttcaacgacggaagacgcctgaggagcgcgtcgagagc
taccaacaagtcacacgccgattggctggatgcatgaaggctatccaggagagtccttgg
gctggactgacagaattgacgcagaaggatggtgacttctgcggcgactcgtccccaaca
cagtcatggtctgctagttgcataatcgacttgttccaagatgcccgcgagtacgagctg
gataaggcgtag

DBGET integrated database retrieval system