KEGG   Phaeosphaeria nodorum: SNOG_03801Help
Entry
SNOG_03801        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
pno  Phaeosphaeria nodorum
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pno00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pno00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 744 aa AA seqDB search
MPATAICSSPIITCSSPPIYFSQASIELEHPTVAFLNFPLTPLVPSPCDAPSGIFGYINY
LVEKDRKYILNTLINGLARLEYRGYDSAGLAIDGDKKNEVFAVKEVGKVASLKKLVDEQN
FDLEKVFDSHAGIAHTRWATHGPPSRVNCHPHRSDPNWEFSVVHNGIITNYKELKTLLES
KGYKFETETDTEAIAKLAKYIYSEHPDLSFPSLVKAVIKELQGAFGLLIKSIHYPHEVVA
ARKGSPLVIGVRTQKKMKVDFVDVEYNDEGAALPAESASHNVALKKGNTLLAPPDKSLLH
RSQSRAFLSDDGVPMPTEFFLSSDPSSIVEHTKKVLYLEDDDVAHIHEGSLNIHRLTKDD
GSVSNVRTIQTLEIQLQEIMKGRFDHFMQKEIFEQPDSVVNAMRGRLDPVNKTVTLGGLR
QYLATIRRCRRIIFIACGTSYHSCMAVRGIFEELTEIPIAVELASDFLDRQAPVFRDDTC
VFVSQSGETADSLMALRYCLERGALTVGIVNSVGSSISLLTHCGVHINAGPEIGVASTKA
YTSQFVCMVMFALSLSEDRASKTKRRAEIMDGLTKISEQFKEALKLDQPIKKLCERFKDQ
KSLLLLGRGSQHATALEGALKIKEISYLHCEAVMSGELKHGVLALVDENLPIVMILTRDD
IFAKSLNAYQQVIARSGRPIIICNKDDPEFPADKTDKIEVPSNVDCLQGLINVIPLQLMS
YWMAVAEGVNVDMPRNLAKSVTVE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctaccgccatttgctcctctcccatcatcacctgctcctcaccacccatatac
ttctcccaagcgtcaattgagctcgaacaccccacagtcgcttttctgaacttcccactc
acaccactcgttccctcgccatgtgacgcacccagcggtatctttggttacatcaactac
ctggtggagaaggacaggaagtacattctcaacacacttatcaatggcctcgcacgtcta
gagtaccgtggttacgactcagctggtctggcaatcgacggtgacaagaagaacgaggtc
ttcgccgtcaaggaggttggcaaggtcgcttcccttaagaagctcgtcgacgagcagaac
ttcgacctcgagaaggtcttcgactcacatgccggtatcgcacacacccgatgggccacc
cacggccccccatcgcgcgtgaactgccatcctcacaggtccgaccctaactgggagttc
tccgtcgtgcacaacggcatcatcacaaactacaaggaattgaagaccctgctcgagagc
aagggctacaagttcgagactgagaccgacaccgaggccattgccaagctcgcaaagtac
atctactctgagcaccccgacctgagcttcccatctctggtcaaggctgtcatcaaggag
cttcagggagctttcggtctgctcatcaagtccatccactacccacatgaggtcgtcgca
gcccgcaagggttcgccccttgtcattggtgtgcggacacagaagaagatgaaggtcgac
ttcgtcgatgtcgagtacaacgacgagggtgctgctctccccgccgagagcgcgtcccac
aacgttgccctgaagaagggtaacaccttgctcgcaccccccgataagtccctcctccac
cgctcgcaatcccgcgctttcctctccgacgatggcgtcccgatgcccaccgagttcttc
ctgtcctccgacccatcttccatcgtcgagcacaccaagaaggtcctctacctcgaggac
gacgacgttgcacacatccacgagggttcgctgaacatccaccgtctcaccaaggacgat
ggctccgtcagcaacgtccgtacgatccagactctggagattcagctccaggagatcatg
aagggccgtttcgaccacttcatgcagaaggagattttcgagcagcccgactccgtcgtc
aacgctatgcgtggtcgtctcgaccctgtcaacaagactgtcactctcggtggtctgagg
caataccttgccaccatcaggcgatgccgcaggatcattttcatcgcttgcggtacctct
taccactcctgcatggccgtccgtggtatcttcgaggagctgaccgagatcccgatcgcg
gttgagctcgcctctgactttttggaccgtcaggcacccgtcttccgtgacgacacctgc
gtcttcgtctcccagtccggtgagaccgctgactcgctcatggctctccgctactgcttg
gagcgcggtgccctgactgttggtatcgtcaactccgtcggttcctccatctctctcctc
acccactgcggtgtgcacatcaacgccggtcccgaaatcggtgttgcctccaccaaggcc
tacacctctcagttcgtctgcatggtcatgttcgcgctgtcgctcagtgaggaccgtgca
tccaagaccaagaggcgcgcggagatcatggacggtcttaccaagatttcagagcagttc
aaggaggcgctcaagctcgaccagcccatcaagaagctctgcgagaggttcaaggaccag
aagtctctgctcctcctcggccgtggctcccagcacgccactgctctcgagggtgctctc
aagatcaaggagatctcatacctccactgcgaagccgtcatgtctggtgagcttaagcac
ggtgtgctcgctcttgttgacgagaacctcccaattgtcatgatcttgacccgcgacgac
atcttcgccaagtcactcaacgcataccagcaggtcattgcccgtagcggacgtcccatc
atcatttgcaacaaggacgaccccgaattcccggcggacaagaccgacaagatcgaggtc
cccagcaacgttgactgcttgcagggtctcatcaacgtcattcctctgcagctcatgtcc
tactggatggcggttgctgagggtgtcaacgtcgacatgccccgtaacttggccaagtcg
gtcaccgtcgagtaa

DBGET integrated database retrieval system