KEGG   Phaeosphaeria nodorum: SNOG_04287Help
Entry
SNOG_04287        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SNOG_04287
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SNOG_04287
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     SNOG_04287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 399 aa AA seqDB search
MRLFHAVSAVQLLAAGLVATAPLDSASTPVIDIDPTVDPLEALAQLQQHAYDTLEQSDVV
SKRAPKGCSLATATIRKDWDYMSKPDRKAYIKAVQCLRTLPSKSDKSWAPAAKTRFDDFV
AIHVNQTMYIHGNGLFLTWHRYFVWAYEQALRNECGYKGYQPYWNWFANTDNIYKSPVFD
GSDTSMGGDGEFFAHNGSLAGARTIVIPSGKGGGCVKSGPFKNTQANIGPISPGMQGFTD
LALDTTDFNPRCLRRDISPYIPQKWFTTANLLNVTIGPGSRTHRLFWTEIQGRYPDGFLG
LHTSGHYTMGGDATDLYSSVNDPAFWLHHAMLDRIYWIWQVLHPKEAGKVAGTLTLQNRP
PTRDAMVEEPLEMGVNGKTVKIKDVLDTMGGSPLCYVYV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtttcatgctgtaagcgccgtgcagctactggctgccggcctcgtggctact
gctcccctcgactcggcctccactccggtcatcgatatcgacccaacagttgatcctctt
gaggctctcgcccaactgcagcagcatgcttatgacacgcttgaacagagcgatgttgtc
tcaaaaagggctccgaagggctgctcattggctaccgcaaccatacggaaagactgggat
tacatgagcaagccggatcggaaagcatacatcaaggctgtacagtgtcttcgaacactg
ccatccaaatccgacaagtcatgggccccagcagcgaagactcgtttcgacgatttcgtc
gccatccatgtgaaccagaccatgtacatccatggtaacggtctcttcctcacatggcat
cgctacttcgtatgggcatacgagcaagccctgcgaaatgaatgcggctacaaaggctac
caaccttactggaactggttcgccaacaccgacaacatctacaaatcccccgtcttcgat
ggtagcgacaccagcatgggtggcgacggcgaattcttcgcacacaacggcagtctcgca
ggcgctcgcaccatcgtcatcccctcaggcaaaggcggaggctgcgtcaagagcggcccc
ttcaagaatacgcaagcaaacatcggccccatctccccgggcatgcaaggctttacagac
ctcgccctcgacacaacagacttcaacccccgctgtctccgccgcgacatctccccttac
atcccgcagaaatggttcacaaccgccaacctactgaacgtcaccatcggccccggctcc
cgcacgcaccgcctcttctggaccgaaatccaaggccgctaccccgacggcttcctcggg
ctgcacacatcgggccactatacgatgggcggcgacgcgacggatttgtacagctcggtt
aacgatcctgcgttttggctgcatcatgcgatgctggatcgcatttattggatttggcag
gtgttgcatccgaaggaggccgggaaggtcgcggggactttgacgttgcagaataggccg
ccgacgagggatgcgatggtggaggagccgctggagatgggggttaatgggaagacggtc
aagattaaggacgttttggatacgatggggggaagtcctttgtgctatgtgtatgtgtga

DBGET integrated database retrieval system