KEGG   Phaeosphaeria nodorum: SNOG_04941Help
Entry
SNOG_04941        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MASASRNFSRALRTAAPSFRATTTRSARFAAPSQPAFRKQWQRSYASSSEGGSEKYEGNP
SGMIAGAAALLAVAAGYGLYIQKPELFGQEPKSASFVPRFEDYQKVYNAIAKRLEEHDNY
DDGSYGPVLVRLAWHASGTYDKLTNTGGSNGATMRFAPEGDHGANAGLKAARDFLEPVKE
AFPWITYSDLWILAGVCSIQEMQGPKIPYRAGRSDRDVSFCTPDGRLPDASKDHSHIRAI
FGRMGFGDKEMVALSGAHALGRCHTDRSGYDGPWTFSPTTMTNDYYKLLLEEKWGYKKWN
GPKQFEDVKTKTLMMLPTDMELVKDKSFRKYTELYAKDNEVFFKDFSDAVMTLFELGVPF
EQPEDQRYVFKSSFD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgcttcacgaaacttctctcgtgctctgcgcaccgcagctccatctttccgt
gcaaccaccacacgctcagctcgctttgccgccccttcgcagcccgcctttcgcaagcag
tggcaacgcagctatgcttccagctctgagggcggatccgagaaatacgagggcaacccc
tccggcatgatcgcgggagctgctgctctgctcgccgtggccgctggttatggcctgtac
atccaaaagcctgagctgtttggccaggagcctaagtccgcctcgttcgtgcccaggttc
gaggactaccagaaggtctacaacgccattgcgaagagacttgaggagcatgacaactac
gacgatggcagttacggccccgtcctggtgcggttggcatggcacgcatctggaacctac
gacaagctcaccaacaccggcggctccaacggcgcaaccatgcgcttcgcccccgaaggc
gaccacggcgccaacgccggcctcaaagccgcccgcgacttcctcgagcccgtgaaggaa
gctttcccctggatcacatactcggacctctggatcctcgccggcgtctgctccatccaa
gaaatgcagggccccaagatcccctaccgcgctggccgctccgaccgcgacgtcagcttc
tgcacgcccgacggccgcctgcctgacgcgagcaaggaccacagccacatccgcgccatc
ttcggccgcatgggcttcggcgacaaggagatggtcgcgctgtctggcgcccacgcgctg
ggccgctgccacactgatcgctcgggctacgatggcccgtggacgttcagccccaccacc
atgaccaacgactactacaagctgctgctcgaggagaagtggggctacaagaagtggaac
ggccccaagcagttcgaggatgtcaagaccaagaccctcatgatgctgccgacggatatg
gagctcgtcaaggataagagcttcaggaagtacacggagctgtacgccaaggataacgag
gtgttcttcaaggactttagtgacgcggttatgacgctgtttgagctcggtgtgccgttt
gagcagcccgaggatcagcgctatgtgttcaagagcagctttgattag

DBGET integrated database retrieval system