KEGG   Phaeosphaeria nodorum: SNOG_04987Help
Entry
SNOG_04987        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pno  Phaeosphaeria nodorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pno00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 376 aa AA seqDB search
MSFSSLVSDIAYRSSERPERPDYRTQVSEARSTRSYASTAATSVSIAGDIKSQLHGGYSH
PLSRAWQAEKQLTKSMLIYPLFISDQPDEETLIPSLPNQHRRGLNKIVPYLTPLVAKGLK
SVILFGVPIAPGAKDALGTNADDPKGPVIRAIRLLRRSFPDLFIVADVCLCEYTSHGHCG
ILRDDGSLNNALSVERVSDVAMSYAMAGAHCVAPSDMNDGRIRAIKLKLIEAGIAHQILL
MSYSAKFSGCLYGPFRDAAGSVPSFGDRRCYQLPPGGRGLARRAIVRDINEGADIIMVKP
ASQYLDIISDAKELGKDMPVAAYQVSGEYAMIHAAAAAGVFDLRQMAEEATQGILRAGAS
IVVSYFTPEFLDWLGN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcttcgctcgtctcagacatcgcctaccgcagctcggagcgtccagaacga
ccagactatcgcacgcaggtctcggaagcgcgctcgacgcgatcatacgccagcactgct
gcgactagcgtgagcattgcaggcgacatcaaaagtcaattgcatggaggctacagccac
ccgctctcgcgagcatggcaggcagagaagcagctcacaaagtccatgctcatataccct
ctcttcatctccgaccagccagacgaggagacgctcattccttcccttccgaaccaacac
cgccgtggcctgaacaagatcgtcccgtaccttaccccactcgttgccaaaggactaaag
tctgtcatactgtttggtgtaccaattgcgccaggtgcaaaagatgcgctgggcacaaat
gcagatgacccgaagggccctgtgatcagggcgatccgcctgctccgaaggtcgttcccc
gatctcttcattgtagccgatgtctgcctttgcgaatacacctcacacggccattgtggt
atcctacgggatgacggcagcttgaacaatgctctttccgtagagcgtgtcagcgatgta
gccatgtcgtatgccatggcaggagctcactgcgtcgcgccctcagacatgaacgacggc
cgcattcgcgccatcaagctcaagcttatcgaagccggtatcgcacaccaaattctcctc
atgtcatactccgccaagttctctggttgtctatatgggccattccgcgacgccgctggc
tcggtcccatctttcggcgaccggagatgctaccaacttcctccaggaggtcgcggtctt
gcgcgtcgagctattgtacgagacatcaacgaaggcgcggacatcatcatggtaaagccc
gcaagtcagtacttggacattatcagcgacgcgaaagagctcggaaaggacatgccagtg
gccgcataccaggtgtctggagagtacgccatgatccacgcagccgcagccgcaggcgtc
ttcgacttgaggcagatggctgaggaggctacgcaaggcatactgcgcgccggtgcttcg
atagtagtcagctacttcactcccgagttcctggactggttgggcaactaa

DBGET integrated database retrieval system