KEGG   Phaeosphaeria nodorum: SNOG_04987Help
Entry
SNOG_04987        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pno  Phaeosphaeria nodorum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SNOG_04987
Enzymes [BR:pno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SNOG_04987
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNOG_04987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 376 aa AA seqDB search
MSFSSLVSDIAYRSSERPERPDYRTQVSEARSTRSYASTAATSVSIAGDIKSQLHGGYSH
PLSRAWQAEKQLTKSMLIYPLFISDQPDEETLIPSLPNQHRRGLNKIVPYLTPLVAKGLK
SVILFGVPIAPGAKDALGTNADDPKGPVIRAIRLLRRSFPDLFIVADVCLCEYTSHGHCG
ILRDDGSLNNALSVERVSDVAMSYAMAGAHCVAPSDMNDGRIRAIKLKLIEAGIAHQILL
MSYSAKFSGCLYGPFRDAAGSVPSFGDRRCYQLPPGGRGLARRAIVRDINEGADIIMVKP
ASQYLDIISDAKELGKDMPVAAYQVSGEYAMIHAAAAAGVFDLRQMAEEATQGILRAGAS
IVVSYFTPEFLDWLGN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcttcgctcgtctcagacatcgcctaccgcagctcggagcgtccagaacga
ccagactatcgcacgcaggtctcggaagcgcgctcgacgcgatcatacgccagcactgct
gcgactagcgtgagcattgcaggcgacatcaaaagtcaattgcatggaggctacagccac
ccgctctcgcgagcatggcaggcagagaagcagctcacaaagtccatgctcatataccct
ctcttcatctccgaccagccagacgaggagacgctcattccttcccttccgaaccaacac
cgccgtggcctgaacaagatcgtcccgtaccttaccccactcgttgccaaaggactaaag
tctgtcatactgtttggtgtaccaattgcgccaggtgcaaaagatgcgctgggcacaaat
gcagatgacccgaagggccctgtgatcagggcgatccgcctgctccgaaggtcgttcccc
gatctcttcattgtagccgatgtctgcctttgcgaatacacctcacacggccattgtggt
atcctacgggatgacggcagcttgaacaatgctctttccgtagagcgtgtcagcgatgta
gccatgtcgtatgccatggcaggagctcactgcgtcgcgccctcagacatgaacgacggc
cgcattcgcgccatcaagctcaagcttatcgaagccggtatcgcacaccaaattctcctc
atgtcatactccgccaagttctctggttgtctatatgggccattccgcgacgccgctggc
tcggtcccatctttcggcgaccggagatgctaccaacttcctccaggaggtcgcggtctt
gcgcgtcgagctattgtacgagacatcaacgaaggcgcggacatcatcatggtaaagccc
gcaagtcagtacttggacattatcagcgacgcgaaagagctcggaaaggacatgccagtg
gccgcataccaggtgtctggagagtacgccatgatccacgcagccgcagccgcaggcgtc
ttcgacttgaggcagatggctgaggaggctacgcaaggcatactgcgcgccggtgcttcg
atagtagtcagctacttcactcccgagttcctggactggttgggcaactaa

DBGET integrated database retrieval system