KEGG   Phaeosphaeria nodorum: SNOG_05146Help
Entry
SNOG_05146        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
pno  Phaeosphaeria nodorum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SNOG_05146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 348 aa AA seqDB search
MALFGAQPAASASSTTGDTSKDVEIPAGQLPSDSISDLQFSPTHDLLAVASWDKKVYIYE
VNGNGAQGKYLFECQGHVLGLGWSKDGTRIAAGDSTGHLNIVDFRSNPASGTIPAQQAKA
HAEAIKCVRWFQTGGQDYVATGSWDKTVKFWDLKGAEPVGTLDAQERVYSMDVKDQLLVV
ATAERHIHTINLQDPTKIYKSITSPLKWQTRVVSCFSDATGFAVGSIEGRCAIQYVEDKD
TRYRDVAKVYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPEVGGSITATAFS
RTGDIFAYAVSYDWSKGYGGNNAQYPIKIKLHPVVGDECKPRPGNKKR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggccttgttcggtgcccaacccgctgcgtctgcaagctctaccaccggcgacactagc
aaggacgtcgagattcccgcaggccagctcccgtctgacagcatatccgacctccagttc
tcgcctacacacgacctgctcgccgtcgcaagctgggacaagaaggtctacatctacgaa
gtcaacggcaatggcgcacagggaaagtacctgttcgagtgccaaggacatgttctgggt
cttggatggtcaaaggacggcacgcgcatagcggctggcgactccaccggccacctcaac
atcgtcgacttccgcagcaaccccgccagcggcaccatccccgcgcaacaagcaaaggcc
cacgccgaagccatcaagtgcgtgcgctggttccaaaccggcggccaagactacgtcgcg
accggctcatgggacaagacggtcaagttctgggacctgaagggcgccgagcctgtgggc
acgctcgatgcgcaagagcgcgtctacagcatggatgtcaaggaccagctcctcgtcgtc
gcgaccgctgagcgtcacattcacaccatcaaccttcaagaccccaccaagatctacaag
tccatcactagcccgctgaaatggcagacgcgcgttgtgtcctgcttcagcgacgcgacc
ggcttcgcagtcggcagtatcgaaggccgttgcgcgattcaatatgttgaagacaaagac
accaggtaccgcgacgtcgccaaagtctactccgtcaacgccatctccttccacccggta
cacggcaccttcagcaccgccggcagcgacggcacattccacttctgggacaaggacgcc
aagcaccgtctcaaaggctacccagaggttggcggcagcatcacagcgacggccttctcg
cgcacaggtgatatctttgcgtacgcggtgagctacgactggagcaaaggctatggcggg
aacaacgcgcagtatccgattaagatcaaactgcaccccgttgtgggagatgagtgcaag
cccaggccagggaacaagaagaggtag

DBGET integrated database retrieval system