KEGG   Phaeosphaeria nodorum: SNOG_05147Help
Entry
SNOG_05147        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pno  Phaeosphaeria nodorum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SNOG_05147
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SNOG_05147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 207 aa AA seqDB search
MAPTDTSAVEKNRAIVISGPSGTGKSTILKRLFEEYPDKFGFSISHTTRGPRAGEEDGRE
YYFVKREEFQDLVDKKGFIEHAQFGDNCYGTSIKAVNDIAEKGRICILDIEMEVDSRPIG
VKQVANHPTFPRPRFLFLSPPSMEILEQRLRSRATDKEEAILKRLKQAKNEMDFANSGEA
PHDKVVVNDDLDKAYKEVKEFIVGSDA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaccgatacctccgccgtggagaagaaccgcgccatcgtgatcagcgggccc
agcggcacgggcaagtcgacgatcctgaagcgcctgttcgaagaataccccgacaaattc
ggcttcagcatttcgcatacgacacgcgggccccgcgccggcgaggaagatgggcgcgag
tactactttgtgaagagggaggagttccaggacttggtggacaagaagggcttcattgag
catgcgcagtttggcgacaactgctatggcacgagcatcaaggcggtcaacgacattgcg
gagaagggcaggatttgtatattggatattgagatggaggtagacagccgccctatcggc
gtcaagcaagtcgcaaaccaccccacgttccctcgtccacgattcctgttcttgtcaccg
ccttcgatggagatcttggagcagcggttgcggagtcgcgcgacggacaaggaggaggct
atccttaagaggctgaaacaggcgaagaacgagatggacttcgcgaacagcggagaggcg
ccgcacgacaaggttgtggtcaacgatgacttggacaaggcgtacaaggaggtcaaggag
ttcattgtcggcagcgacgcatga

DBGET integrated database retrieval system