KEGG   Parastagonospora nodorum: SNOG_05147Help
Entry
SNOG_05147        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pno  Parastagonospora nodorum
Pathway
pno00230  Purine metabolism
pno01100  Metabolic pathways
Module
pno_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SNOG_05147
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SNOG_05147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_28 AAA_18 AAA_22 ABC_tran DUF2075 AAA_30 MMR_HSR1 RsgA_GTPase T2SSE AAA_29 AAA_14 AAA_24 Rad17 AAA RNA_helicase NTPase_1 AAA_17 Cytidylate_kin AAA_5 ATPase_2 dNK AAA_19 KAP_NTPase AAA_23 AAA_11 Sigma54_activat cobW NACHT IstB_IS21
Motif
Other DBs
NCBI-GeneID: 5972432
NCBI-ProteinID: XP_001795557
UniProt: Q0USW7
Position
Unknown
AA seq 207 aa AA seqDB search
MAPTDTSAVEKNRAIVISGPSGTGKSTILKRLFEEYPDKFGFSISHTTRGPRAGEEDGRE
YYFVKREEFQDLVDKKGFIEHAQFGDNCYGTSIKAVNDIAEKGRICILDIEMEVDSRPIG
VKQVANHPTFPRPRFLFLSPPSMEILEQRLRSRATDKEEAILKRLKQAKNEMDFANSGEA
PHDKVVVNDDLDKAYKEVKEFIVGSDA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaccgatacctccgccgtggagaagaaccgcgccatcgtgatcagcgggccc
agcggcacgggcaagtcgacgatcctgaagcgcctgttcgaagaataccccgacaaattc
ggcttcagcatttcgcatacgacacgcgggccccgcgccggcgaggaagatgggcgcgag
tactactttgtgaagagggaggagttccaggacttggtggacaagaagggcttcattgag
catgcgcagtttggcgacaactgctatggcacgagcatcaaggcggtcaacgacattgcg
gagaagggcaggatttgtatattggatattgagatggaggtagacagccgccctatcggc
gtcaagcaagtcgcaaaccaccccacgttccctcgtccacgattcctgttcttgtcaccg
ccttcgatggagatcttggagcagcggttgcggagtcgcgcgacggacaaggaggaggct
atccttaagaggctgaaacaggcgaagaacgagatggacttcgcgaacagcggagaggcg
ccgcacgacaaggttgtggtcaacgatgacttggacaaggcgtacaaggaggtcaaggag
ttcattgtcggcagcgacgcatga

DBGET integrated database retrieval system