KEGG   Phaeosphaeria nodorum: SNOG_05626Help
Entry
SNOG_05626        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNOG_05626
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SNOG_05626
Enzymes [BR:pno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SNOG_05626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MSHADAEDAQFQKEVQEVKQWWTDSRWRFTRRPFTAEEIVAKRGNLKIQYPSNSQSKKLW
NIVEQRFKNNDVSYTYGCLDPVMVTQMAKYLDTVYVSGWQCSSTASSTDEPGPDLADYPY
TTVPNKVGHLFMAQLFHDRKQREERLTTPKADRAKLANTDFLRPIIADADTGHGGLTAIM
KLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
VARTDSEAATLITSTIDPRDHYYIMGCTNPALQPLGELMYAAEQAGKNGAQLQAIEDAWT
KEANLKLYHEAVIDTINAGVHVNKQDLIQQFLQKSKGKSNSEARAIAQGLTGVDVYFNWE
AARTREGYYRYQGGCETAINRAVAYAPYCDMIWMESKLPDFAQAKEFADGVHAVWPEQKL
AYNLSPSFNWKTAMPRDEQETYIQRLAKLGYCWQFITLAGLHQSALMADTFSKAYAKQGM
RAYGEIIQEPEAENKVDVLTHQKWSGANYVDNMLKMVSGGVSSTAAMGKGVTEDQFK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgcagacgcagaagacgcgcagtttcagaaggaggttcaggaggtgaagcaa
tggtggaccgactcaagatggcgattcacccgaaggccattcaccgcagaggagattgtc
gcaaagagaggcaaccttaagatccaatacccaagtaatagccaatcaaagaagctctgg
aacatcgtggaacaacgattcaagaacaacgatgtcagctacacatatggctgtcttgac
ccggttatggttacacagatggccaagtacctagacactgtatacgtctctggctggcaa
tgttcatcaacagcatcttcgaccgacgagcctggtccagatctggcagattacccctac
accactgtacctaacaaagttggccatctcttcatggcacagcttttccacgaccgaaag
cagcgcgaagagcgcttgaccacaccaaaagcagaccgtgcgaagctcgcgaacactgac
ttcctccgaccaattattgccgatgcagatactggacacggaggcctgacagcaattatg
aagctcacgaagctgtttattgagaagggcgccgctggtattcacatcgaagatcaagcg
ccaggcacaaagaagtgtggccatatggctggaaaagtgctcgtaccaatcagcgagcac
atcaaccgattggttgctatccgtgctcaggcagatatcatgggtaccgatctcctcgcg
gtcgcccgtaccgattctgaagccgctaccctcatcacttcgaccattgacccacgcgat
cactactacatcatgggttgtacaaacccggcactccagccactcggcgagctcatgtac
gctgctgagcaagctggaaagaatggtgcacagctccaggcgatcgaagacgcatggacg
aaggaggcgaacttgaagctttaccacgaggctgtcattgacacgatcaatgccggtgta
cacgttaacaagcaagacctcatccagcaattcttgcagaagagcaagggcaagagcaac
tccgaggctcgtgccattgcacaaggcttgacaggcgtcgatgtctacttcaactgggaa
gctgccaggacgcgagagggctactacaggtaccagggtggctgcgaaaccgccatcaac
cgcgccgttgcctacgcaccctactgcgacatgatatggatggagtcgaagctgcccgac
ttcgcccaagcgaaggagttcgcagacggtgtccatgccgtctggcccgagcaaaaactc
gcatacaacctctctccctccttcaactggaagaccgccatgccccgcgatgagcaagag
acgtacatccagcgtctcgccaagctcggttactgctggcaattcatcacgcttgctggt
ctgcaccagagtgcgctcatggcggacaccttctcgaaagcgtatgccaagcagggtatg
cgtgcgtacggcgagatcatccaagagccggaggcggagaacaaggtcgatgttcttacg
catcagaagtggagtggagcgaattatgtggacaatatgctcaagatggttagtggcggt
gtgagctcgacggcggcgatgggtaagggtgttacggaggatcagttcaagtaa

DBGET integrated database retrieval system