KEGG   Phaeosphaeria nodorum: SNOG_05626Help
Entry
SNOG_05626        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:pno01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pno00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MSHADAEDAQFQKEVQEVKQWWTDSRWRFTRRPFTAEEIVAKRGNLKIQYPSNSQSKKLW
NIVEQRFKNNDVSYTYGCLDPVMVTQMAKYLDTVYVSGWQCSSTASSTDEPGPDLADYPY
TTVPNKVGHLFMAQLFHDRKQREERLTTPKADRAKLANTDFLRPIIADADTGHGGLTAIM
KLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
VARTDSEAATLITSTIDPRDHYYIMGCTNPALQPLGELMYAAEQAGKNGAQLQAIEDAWT
KEANLKLYHEAVIDTINAGVHVNKQDLIQQFLQKSKGKSNSEARAIAQGLTGVDVYFNWE
AARTREGYYRYQGGCETAINRAVAYAPYCDMIWMESKLPDFAQAKEFADGVHAVWPEQKL
AYNLSPSFNWKTAMPRDEQETYIQRLAKLGYCWQFITLAGLHQSALMADTFSKAYAKQGM
RAYGEIIQEPEAENKVDVLTHQKWSGANYVDNMLKMVSGGVSSTAAMGKGVTEDQFK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgcagacgcagaagacgcgcagtttcagaaggaggttcaggaggtgaagcaa
tggtggaccgactcaagatggcgattcacccgaaggccattcaccgcagaggagattgtc
gcaaagagaggcaaccttaagatccaatacccaagtaatagccaatcaaagaagctctgg
aacatcgtggaacaacgattcaagaacaacgatgtcagctacacatatggctgtcttgac
ccggttatggttacacagatggccaagtacctagacactgtatacgtctctggctggcaa
tgttcatcaacagcatcttcgaccgacgagcctggtccagatctggcagattacccctac
accactgtacctaacaaagttggccatctcttcatggcacagcttttccacgaccgaaag
cagcgcgaagagcgcttgaccacaccaaaagcagaccgtgcgaagctcgcgaacactgac
ttcctccgaccaattattgccgatgcagatactggacacggaggcctgacagcaattatg
aagctcacgaagctgtttattgagaagggcgccgctggtattcacatcgaagatcaagcg
ccaggcacaaagaagtgtggccatatggctggaaaagtgctcgtaccaatcagcgagcac
atcaaccgattggttgctatccgtgctcaggcagatatcatgggtaccgatctcctcgcg
gtcgcccgtaccgattctgaagccgctaccctcatcacttcgaccattgacccacgcgat
cactactacatcatgggttgtacaaacccggcactccagccactcggcgagctcatgtac
gctgctgagcaagctggaaagaatggtgcacagctccaggcgatcgaagacgcatggacg
aaggaggcgaacttgaagctttaccacgaggctgtcattgacacgatcaatgccggtgta
cacgttaacaagcaagacctcatccagcaattcttgcagaagagcaagggcaagagcaac
tccgaggctcgtgccattgcacaaggcttgacaggcgtcgatgtctacttcaactgggaa
gctgccaggacgcgagagggctactacaggtaccagggtggctgcgaaaccgccatcaac
cgcgccgttgcctacgcaccctactgcgacatgatatggatggagtcgaagctgcccgac
ttcgcccaagcgaaggagttcgcagacggtgtccatgccgtctggcccgagcaaaaactc
gcatacaacctctctccctccttcaactggaagaccgccatgccccgcgatgagcaagag
acgtacatccagcgtctcgccaagctcggttactgctggcaattcatcacgcttgctggt
ctgcaccagagtgcgctcatggcggacaccttctcgaaagcgtatgccaagcagggtatg
cgtgcgtacggcgagatcatccaagagccggaggcggagaacaaggtcgatgttcttacg
catcagaagtggagtggagcgaattatgtggacaatatgctcaagatggttagtggcggt
gtgagctcgacggcggcgatgggtaagggtgttacggaggatcagttcaagtaa

DBGET integrated database retrieval system